[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF53649.1

[Show Plain Result]


## Summary of Sequence Search
    1::317
    2::230     1e-26  37%  232 aa  PF01370 Epimerase "NAD dependent epimerase/dehydratase family"
    2::264     2e-10  31%  282 aa  PF04321 RmlD_sub_bind "RmlD substrate binding domain"
    2::240     2e-09  32%  291 aa  PF02719 Polysacc_synt_2 "Polysaccharide biosynthesis protein"
    1::214     8e-08  30%  261 aa  PF01073 3Beta_HSD "3-beta hydroxysteroid dehydrogenase/isomerase
    1::317

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xRCVITGGAGFLGSHLTDLILNQGHEVIVLDDLSTGSLSNLFHQISNPRLQIKTVDVRKKFEIDGPVDIV
PF01370         ---LVTGGAGFIGSHLVRRLLERGYEVVNLSRRGRSAL------LADERLRVEFVDLTDPDALDEALDAV
PF04321         -KILITGANGQLGRELQRLLAERGYEVVALD---------------RSELDITDPDAVEAVVREVKPDVV
PF02719         ---LVTGGGGSIGSELCRQILKFNPKKLILFDRSENKLYEIEQELPDPKLRFFVGDVRDRDRLEGP-DYV
PF01073         ---LVTGGSGFLGSHIVRQLLERGYEVRVLDRSPSPELLEELEKLGATYVEGDITDPESLREAFQGVDVV


                         .         .         *         .         .         .         .:140
query           FNLASPASPPVYTQRRVECLLINSEAVLQVAEFALEKGARLVQASTSEVYGDPLSHPQLEHHWGNVNPIG
PF01370         IHLAAQSGVGRSIDDPAEFIEVNVVGTLNLLEAARKAGVRFVFASSAAVYGDPAGGPITED-----TPLG
PF04321         INCAAYTAVDKAESEPELAYAINATGPRNLAEAAAEVGARLVHISTDYVFDGTKGRPYTED-----DPPN
PF02719         FHAAALKHVPLMEYNPMEAVKNNVLGTENVAEAAIEAGVKFVLISTDKA----------------VNP--
PF01073         FHTASPVD--VWGKDNEEELYVNVEGTKNVLEACKKAGVRLVYTSSASVVFPSRGDDIINGDESTPYPSK


                         +         .         .         .         .         *         .:210
query           ERSCYDEGKRFAEALLSAMRLEQGLNAGIIRIFNTYGPRMHPFDGRVISGFVRQALANEPLTVFGDGSQT
PF01370         PLSPYGASKLAAERLARAYARAYGLPVVILRPFNVYGPGGFPTG--LIPLLIRRALGGKPLPVYGDGTQV
PF04321         PLNVYGRSKLAGEQAV----LEAGPKHLILRTSWVYG----PYGNNFVKTMLRLAKERDELKVVDD--QI
PF02719         -TNVMGASKRLAEKLLQALNRESSTRFSAVRFGNVLGSR-----GSVIPLFKKQIAKGGPVTV-THPDMT
PF01073         FLDPYAESKALAEAVLAANGNGGTLLTCALRPAGIYGPGDPLLVPRLL-----EAARNGVLFRIGDGNNL


                         .         .         .         +         .         .         .:280
query           RSFCYVSDLVRGLWLMGNSNQPGPINLGNPIEQTVLSMAHLIKESTNSESSITFEPLPSDDPVRRRPDIS
PF01370         RDFIHVDDLARAHLLALENPEAGEIYL-------------------------------------------
PF04321         GSPTYAEDLARALHLIERALAYGIYHLSNEFAKAIFELAGLVKPITTAE-----YPTPAKRPANSVLDTS
PF02719         RYFMTIPEAVQLVLQAGAMGKGGEIDMGEPVKIVDLAKA-------------------------------
PF01073         VDFVYVGNV-------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAKELLGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01370         -------------------------------------
PF04321         KLKATFG------------------------------
PF02719         -------------------------------------
PF01073         -------------------------------------