[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF53786.1

[Show Plain Result]


## Summary of Sequence Search
    1::498
    4::423     7e-40  34%  436 aa  PF03972 MmgE_PrpD "MmgE/PrpD family"
    1::498

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxEHLAWKISELATDPVEVTPDVSEMIINRIIDNAAVSAASVLRRPVTVARQQA
PF03972         ------------------EQLADFVANLRYD--DLPAEVLERAKRCLLDTLGCALAGLREPPVRKLLGAV


                         .         .         *         .         .         .         .:140
query           QSHPREKGGKVFGISGSYSPEWAAFANGVAVRELDFHDTFLAAEYSHPGDNIPPLLAVAQAQRSSGRDLI
PF03972         PGTGGPGGATVPGTGRRLDPVNAAFANGAAIHALDFDDTHLAAEGHPPADVLPAALAVAEALGASGRDLL


                         +         .         .         .         .         *         .:210
query           RGIATAYEVQVELVKGICLHEHKIDHVAHLGPSAAAGLGTLLHVDEETIYQAIGQALHTTTATRQSRKGE
PF03972         TAMIAGYEIQGRLGLANSLNHYGFDHVTLGAFAAAAAAARLLGLDAEQIANALGLAASQASGLRTYRGGP


                         .         .         .         +         .         .         .:280
query           ISSWKAFAPAFAGKMAIEAMDRAMRGEGSPAPIWEGEDGVIAWLLSGKDHVYHVPLPEHGEPKLGILETY
PF03972         NTGSRKWAAGDAARNGVRAALLARAGFTGPADILEGPWGFFAVLFGGPDFDLARPLGE----SWAIENVL


                         .         *         .         .         .         .         +:350
query           TKEHSAEYQSQAPIDLARRMKPLVDAAGGTEHIAEIVLRTSHHTHYVIGTGANDPQKMDPQASRETLDHS
PF03972         FKPYPACRHAHTAIDAALALR--AEHGLRADDIERITVRTHEAAIRIIG-------KPGPPATPADADFS


                         .         .         .         .         *         .         .:420
query           IMYIFAVALQDGVWHHEFSYTRKRSTRPETVELWHKIRTVEDPEWTRRYHSDDPAKKAFGAKAVITMADG
PF03972         LPYIVAVALLDGRLGLA-DYEDAAAADPRVDALRAKVRVVEDPELT----ADYPAKRSI--VVVVLLDGG


                         .         .         +         .         .         .         .:490
query           TLIEDELAVADAHPLGARPFARENYIEKFRTLAQGIVIDSExxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03972         RTLEVEVEYPKGHP--RRPLSREELEAKFRRLAAGVLPEAE-----------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxx
PF03972         --------