[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF53863.1

[Show Plain Result]


## Summary of Sequence Search
    1::197
  127::178     1e-08  50%  198 aa  PF01863 DUF45 "Protein of unknown function DUF45"
   66::127     2e-04  37%  185 aa  PF08325 WLM "WLM domain"
    1::197

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01863         ----------------------------------------------------------------------
PF08325         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVSNQKGRWGSCTVATAEIR
PF01863         ---------------------------------------------------IRDMKTRWGSCS-AKGEIR
PF08325         --------------------------------------------------------------------LR


                         +         .         .         .         .         *         .:210
query           ISDRLKHVPDYVLDAVLVHELTHTFIAGHSAEFWEWADKTPLAERAKGYLEAYQRWG
PF01863         LNWRLIMAPPEVLDYVVVHELAHLKEMNHSKAFW-----------------------
PF08325         TDDDNGFLPYETILATLLHELAHNVHGPHDAKFYKLLDQ--LRDEAKGYTEGFWSWG