[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF53909.1

[Show Plain Result]


## Summary of Sequence Search
    1::175
   34::161     3e-20  48%  162 aa  PF10969 DUF2771 "Protein of unknown function (DUF2771)"
    1::175

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPQEISISASSPAGEIEVFPFSMCEPGVE
PF10969         ------------------------------------------PQLPEITAYSHGHLVEVGPYQYCDLGLD


                         .         .         *         .         .         .         .:140
query           CEENEVPTLEVGADEELHLTIPEAIHDHDWYLLTIYDDPAANDEFYHTSYDATEATVPGSVDPTEEGAER
PF10969         CDEPEAPELDVPPGYPVQLSVPEDIADAPWRLLQIYDDPAGNDETEFRPGERLAVTIPGSVDP-----ER


                         +         .         .         .         .         *         .:210
query           PRLVVVEVSAVMIGEDENGEESPYTVTWSLSTxxx
PF10969         PRLVGVEVQLLTLVIDENGEETPVPAVWSIST---