[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF53991.1

[Show Plain Result]


## Summary of Sequence Search
    1::160
    4::116     9e-06  30%  132 aa  PF08534 Redoxin "Redoxin"
    1::160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGL
PF08534         ----DKAPDFTLDA---LDGKPVTLSDFKGKVVVLNFWASWCPPCAEH--PYLEELAEEYKAKGVDVVGV


                         .         .         *         .         .         .         .:140
query           HSVFEHHDVMTPEALKVFISEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIxxxxxxx
PF08534         NSDDD------PFAVMRFLGKEGLPYPVLSDGDGE------FGKALGVYGSPRTFLIDKDGKV-------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxx
PF08534         --------------------