[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF54079.1

[Show Plain Result]


## Summary of Sequence Search
    1::188
    2::135     3e-09  35%  149 aa  PF03358 FMN_red "NADPH-dependent FMN reductase"
    1::188

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxKIAIITGSTRPGRVNIDVANWVLERAQERNDAQYELVDIADFNFPVLDEAMPAGYGQYANEHTKAWAA
PF03358         --KILVINGSPRKNGNTRKLAEAAAEGAEEAG-AEVELIDLADLILPLCDKDLEC---EVIPDDVQELLE


                         .         .         *         .         .         .         .:140
query           KIAEFDGFIFVTGEYNHSVPAALTNALSYLSAEWNNKAAGIVSYGSAMGVRAAEHLRGILSELxxxxxxx
PF03358         KLAEADGIIFGTPTYFGSMSGQLKNFLDRLSGLWAGKPAAVTSGGQHGGQEATLQLRPILAHL-------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03358         ------------------------------------------------