[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF54082.1

[Show Plain Result]


## Summary of Sequence Search
    1::408
    2::268     7e-18  30%  347 aa  PF07690 MFS_1 "Major Facilitator Superfamily"
   38::161     4e-09  38%  433 aa  PF00083 Sugar_tr "Sugar (and other) transporter"
    1::408

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxLALGVFGVGVTEFVPVGLLPQIANTFDTSIATTGWVISSYAAGVMVGAPIMT
PF07690         ------------------LLLGYFLSGLDRSILSPALPALAEDLGLSPSQVGLLLSAFLLGYALGSPPAG
PF00083         --------------------------------------------------TGLVVSILFLGALIGALFFG


                         .         .         *         .         .         .         .:140
query           LLSIRRPRKQMLIILMVLFIIGNLLSAVAPNFALLIIGRIVTSFTHGAFFGIGTVVAAELAGPGQRGAAV
PF07690         PLADRFGRRRVLLLGLLLFALGSLLLAFASNSWLLLVARFLQGLGAGGLFPAASALIADWFPPEERGRAL
PF00083         PLADRFGRKKALLLSLLLMAVGTLLIAFAPNPALLIVGRFLQGLGVGGESGVAPVYISEIAPPKKRGFLV


                         +         .         .         .         .         *         .:210
query           AYMFSGISLANLIGVPIGTWIGTMANWRTTFLVIAALGILTAVAIAYLVPNLPSPKNVRVGREIKALTHP
PF07690         GIFSAGGGLGAALGPLLGGLLAESLGWRWAFLILAILGLLALLLALLLLPEPPSPAEKLLERPLKLLLKN
PF00083         SFITLGILLAALVGYGL-SLIGGDWGWRIPF---------------------------------------


                         .         .         .         +         .         .         .:280
query           QVILALLMTLFGFGGVFAALTYLTPIMTDIAGYAESSMSWILIIVGVGMFTGNWTGGKLADRxxxxxxxx
PF07690         PVLWLLLLALFLFGGFYGLLTFLPLYLQEVLGFSALQAGLLLALGGLVGAIGSLLGGRLSDR--------
PF00083         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------
PF00083         ----------------------------------------------------------