[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF54084.1

[Show Plain Result]


## Summary of Sequence Search
    1::81
    1::52      3e-04  48%   53 aa  PF02609 Exonuc_VII_S "Exonuclease VII small subunit"
    1::81

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxYERARDELVEIVKILELGQMGLDESLKYWERGEALAKRCEEHLAGAS
PF02609         -----------------------FEEALAELEEIVEKLESGELSLEESLELYERGMELLKLCQEKLEQAE


                         .         .         *         .         .         .         .:140
query           ARVEQxxxxxx
PF02609         QKVEK------