[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF54269.1

[Show Plain Result]


## Summary of Sequence Search
    1::325
    2::289     3e-55  44%  289 aa  PF00231 ATP-synt "ATP synthase"
    1::325

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxTIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASASSLDHPMLRER
PF00231         --SLKEIRRRIKSVKNTQKITKAMKMVAASKLRKAQERAEAARPYAEKLREVLSHLASASDYDHPLLEER


                         .         .         *         .         .         .         .:140
query           EGGKRAAVLVVTSDRGMAGGYNHNVXXXXXXXXXXXXXSGYEVVRYVTGKKGVDYYKFRAEDVAGAWTGF
PF00231         EV-KKVLLIVITSDRGLCGGFNSNIIKAAERLIKELKAKGKEVDLIVIGKKGRDFFKRRGINVVASFTGL


                         +         .         .         .         .         *         .:210
query           SQDPDWAATHNVRRHLIDGFTASSEGEAAWREGLNLSEGQDIQGFDQVHVVYTEFISMLTQNPVVHQLLP
PF00231         GDKPTFEEASEIADELLDLYL---NGE-----------------YDEVYIVYNKFVSAISQEPTVEQLL-


                         .         .         .         +         .         .         .:280
query           VEPVIEDEIFEKGEDLLSSSGDVEPDYEFEPDADTLLEALLPQYVSRRLFSIFLXXXXXXXXXXXNAMKS
PF00231         --PLAEEEEEDEEEEAESSS-----DYEYEPDPEEILDALLPRYLESQIYRALLESAASEHAARMTAMDS


                         .         *         .         .         .         .         +:350
query           ATDNASELVKDLSRVANQARQAQITQEITEIVGGAGALxxxxxxx
PF00231         ATDNAGELIDKLTLLYNRARQAAITQELIEIVSGAEAL-------