[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF54313.1

[Show Plain Result]


## Summary of Sequence Search
    1::123
    1::134     3e-15  42%  135 aa  PF05025 RbsD_FucU "RbsD / FucU transport protein family"
    1::123

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKSGLLNPDLCYAIARLGHTDTWAVADCGLPIPEHVEIIDLALVFGIPTFEQVLNALKPXXXXXXXXXX
PF05025         MKKPPILNPELLKVLAEMGHGDEIVIADAGFPIPKGTERIDLALRAGGPSFLDVLDAI----LSEMPLEK


                         .         .         *         .         .         .         .:140
query           XXTPERIRXXXXXXXXXXXXXXLKAQLAECAFVIRTGETTAYANVIFKSGVxx
PF05025         VVLAEEIKMENPELLPEIEDELEKAEGPEIEIVIRTGETTPYANIILKKGV--