[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF54336.1

[Show Plain Result]


## Summary of Sequence Search
    1::391
    5::187     3e-07  30%  200 aa  PF09084 NMT1 "NMT1/THI5 like"
    1::391

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKH
PF09084         --------------------------------------------------------------------EE


                         .         .         *         .         .         .         .:140
query           GVNVTLKKYSGWSDLWTAYATEQLDVAHMLSPMTVAINAGVTNASRPMELSFTQNTNGQAITLASKHYGS
PF09084         GLDVELVEFAGGAAVLEALASGKADFAVAGPPPVLAARA----KGAPVKVAALYQSEGQALVVRKD--SG


                         +         .         .         .         .         *         .:210
query           VNSAADLKGMVLGIPFEYSVHALLLRDYLASNAVDPIADLKLRLLPPADMVAQLTVEGIAGFIGPEPFNE
PF09084         IKSLADLKGKRIGVPGGSSTE-YLLRALLAKAGLDP-DDVTLVNLGPADAAAALQVDAAAWFPPWEPVEA


                         .         .         .         +         .         .         .:280
query           RAISNGSGRIWLLTKQVWDKHPCCAVAKAKEWKAEHPTAAQGVLNALxxxxxxxxxxxxxxxxxxxxxxx
PF09084         EA--EGVDLRVLLLADLGVNFPGDVLVAREDFLEENPELVKAFLKAL-----------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09084         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09084         -----------------------------------------