[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF54487.1

[Show Plain Result]


## Summary of Sequence Search
    1::268
  157::299     2e-18  42%  299 aa  PF02535 Zip "ZIP Zinc transporter"
    1::268

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02535         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMGVLTALAIAIHNFPEG
PF02535         -----------------------------------------------------IGLLLLLGISLHNFPEG


                         +         .         .         .         .         *         .:210
query           FATFLAGLSDPTXXXXXXXXXXXHNIPEGIAVAVPLREATGSRRKALGWATLSGLAEPAGALIGFLLLMP
PF02535         LALGASFSASPTLGLSLFIAIFIHNIPEGFALGAPLLQAGFSKRKALLLALLFGLSAPLGAALG-LLING


                         .         .         .         +         .         .         .:280
query           FIGPEALGLCFAAVAGVMVFISVDELLPTAISSGKHHTAIYGLIAGMAVMAISxxxxx
PF02535         SSGTSLLGILLAFAAGTFLYVALVELLPEALESGKRLLAFLGLLLGFGLMALS-----