[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF54635.1

[Show Plain Result]


## Summary of Sequence Search
    1::422
    3::169     3e-60  66%  169 aa  PF00925 GTP_cyclohydro2 "GTP cyclohydrolase II"
    1::194     3e-54  59%  194 aa  PF00926 DHBP_synthase "3,4-dihydroxy-2-butanone 4-phosphate
    1::422

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxVEEAIADIAAGKAXXXXXXXXXXXXXXIIFAAELATPELVAFMVRYSSGYICAPLTA
PF00925         ----------------------------------------------------------------------
PF00926         -------------IEEAIEALRNGKMVIVVDDEDRENEGDLIIAAEAVTPEQIAFMIRHGSGLICLPLTE


                         .         .         *         .         .         .         .:140
query           KDADRLDLPPMTAHNQDARGTAYTVTVDANTGTTGISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAR
PF00925         ----------------------------------------------------------------------
PF00926         ERADRLGLPPMVTNNTDPHGTAFTVSVDAADGTTGISAADRALTIRALADPDAKPEDFRRPGHVFPLRAR


                         +         .         .         .         .         *         .:210
query           EGGVLVRAGHTEAAVDLARAAGLRPAGVICEVVSEEDPTGMARVPELRRFCDEHDLKLISIEQLIEWRxx
PF00925         ----------------------------------------------------------------------
PF00926         DGGVLERRGHTEAAVDLARLAGLKPAGVICEILNDDGT--MARLPDLLAFAKKHGLKVITIEDLIEYR--


                         .         .         .         +         .         .         .:280
query           xxxxxxRQVETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVASDGGENVLVRVHSECLTGDVFGSRRCD
PF00925         ------RVAEARLPTRFGEFRLVGYRDLIDGKEHLALVKGDIDPD--EPVLVRVHSECLTGDVFGSLRCD
PF00926         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           CGQQLHESLRLIQEAGRGVVVYMRGHEGRGIGLLAKLRAYQLQDEGADTVDANLALGLPADAREFGTSAQ
PF00925         CGEQLDEALRLIAEEGRGVLVYLR-QEGRGIGLLNKLKAYNLQDLGLDTVEANLLLGFPADARDYGLGAQ
PF00926         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ILYDLGVRSLNLISNNPAKKVGLEGHGISIASRTPIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00925         ILRDLGVKKIRLLTNNPDKIVALEGFGLEVVERVPI----------------------------------
PF00926         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xx
PF00925         --
PF00926         --