[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF54728.1

[Show Plain Result]


## Summary of Sequence Search
    1::149
    4::128     6e-23  52%  128 aa  PF00692 dUTPase "dUTPase"
    1::149

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLA
PF00692         ------------------PAYATAGDAGYDLRAAEDVVLPPGERALVPTGLAIELPDGYEGQIRPRSGL-


                         .         .         *         .         .         .         .:140
query           AREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQ
PF00692         ARKGLIVLPA-GVIDSDYRGEIGVILINLG-DEPFTIEKGDRIAQLVFAPVVQAEFEEVEELDETERGEG


                         +         .         .         .         .         *         .:210
query           GYGSTGxxx
PF00692         GFGSTG---