[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF54831.1

[Show Plain Result]


## Summary of Sequence Search
    1::622
    1::281     2e-23  36%  289 aa  PF00905 Transpeptidase "Penicillin binding protein transpeptidase
    1::115     7e-09  28%  118 aa  PF05223 MecA_N "NTF2-like N-terminal transpeptidase domain"
    1::622

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDTADPIAEEFLQAWASQDFDTIADITDQADLATEMLSTSF
PF00905         ----------------------------------------------------------------------
PF05223         ------------------------------ESPEEAAEEYIDAWNKGDYAAMYDLLSKPDISTERYQKIY


                         .         .         *         .         .         .         .:140
query           DGLQADSVELTLDSVDSRDTIATANFSVVWKLPRDREVSYDSSMTLTKMRNEWTVRWEPSLVHPKLGxxx
PF00905         ----------------------------------------------------------------------
PF05223         EGLGAKDLKVEDKKVKKKKDKATVPYKVSMDTPAGKIWEYDTQLELVKDDDTWKVDWSPSVIFPGLG---


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00905         ----------------------------------------------------------------------
PF05223         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00905         ----------------------------------------------------------------------
PF05223         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAMMVVMRPSTGEILAVAQTDEAD
PF00905         -----------------------------------------------AAAVVMDPKTGEVLAMVGGPDYD
PF05223         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KDGDVALMGQYPPGSTFKIITAAAGLAHEGLTPDSIVPCPGTMNIYGRIVTNYNSFSLGNTSLDDAFANS
PF00905         PNKNRATQAVRQPGSTFKPFTYAAALEEGVITPNTTIDDPPIYPVGGYTPKNWDRGGHGPVTLREALAKS
PF05223         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           CNTTFADISTNLEPGQLKNVAKQFGLGIDYQIPGLDTMTGSVPAGDIVLDRTESGYGQGLDLASPFGMAL
PF00905         SNVYFVRLALKLGPDRLADYAKKFGLGVK---TGID-LPGEVPG-----DTATLAIGQGSVSVTPLQLAN
PF05223         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           VASTAATGSVPTPTLISGHETVASEEVPALDPEVLANVQRMMKSVVNDGTARGMRQTGGQIYAKTGEAEI
PF00905         AYATIANGGVRVPHLVDADGNVVEKEPPPLSPETAYLVREMMRGVVTGGTGRAAKVPGYPVAGKTGTAQV
PF05223         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           NEGSHAWFTGYREDDIAFATLVVLGGGSEAAAAxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00905         GDGGDAWFVGFAPADIAVAVWVGNGGYGGGVAA-----------------------------
PF05223         --------------------------------------------------------------