[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF54857.1

[Show Plain Result]


## Summary of Sequence Search
    1::314
   41::233     3e-11  29%  235 aa  PF01497 Peripla_BP_2 "Periplasmic binding protein"
    1::314

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01497         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIADCGLRQSPDIEAIANLNPTLICANSRADEEVLNK
PF01497         ----------------------------------VPDVGGRGEPNLEAIAALKPDLIIASGSGAAEALYE


                         +         .         .         .         .         *         .:210
query           LRTIAPVVTGEGGGENWKQDLLTIAEAAGQKEKAETLLKSYEDSAAEIAANQPANPPTVSFLRTKDQEFQ
PF01497         LLSAAPVVVPDSLGEDWLESIRLLGKALGKEERAEALIADLDARLAAVKARAAAKPPVLVFLLAGGGTLY


                         .         .         .         +         .         .         .:280
query           MYGAQSMAGTVAADCGYARPENQQFTDTAGQDLSAELIAQADADWLFYGMKEGNINPEDTPLWTSLKAVQ
PF01497         VAGGGSFIGELLELLG-GKNAAADLKGGGSAPVSLEQLLAADPDVIFVTGRGEDAAAAENPLWKNLPAVK


                         .         *         .         .         .         .         +:350
query           SNQAIPVDxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01497         NGRVYVLD--------------------------