[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF55227.1

[Show Plain Result]


## Summary of Sequence Search
    1::106
    6::109     1e-34  75%  109 aa  PF06421 LepA_C "GTP-binding protein LepA C-terminus"
    1::106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLAKCYGGDISRK
PF06421         VDALSFIVHRDKAYSRGRELVEKLKELIPRQQFEVPIQAAIGGKIIARETIKALRKDVLAKCYGGDISRK


                         .         .         *         .         .         .         .:140
query           RKLLEKQKAGKKRMKNIGSVEVPQEAFVAALSTDxx
PF06421         RKLLEKQKEGKKRMKQVGNVEIPQEAFLAVLKVD--