[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF55235.1

[Show Plain Result]


## Summary of Sequence Search
    1::196
  182::230     2e-05  48%  268 aa  PF03934 GspK "General secretion pathway protein K"
    1::196

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03934         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxISLNT
PF03934         -----------------------------------------------------------------ININT


                         +         .         .         .         .         *         .:210
query           ATVADLVTLPGVGEKTAQAIIDFRESNGGFSTVEDLLQVKGIGPSxxxxxxxxxxx
PF03934         ASAEVLAALPGLSLSKAQAILSYRPAN-GFRSVDDFLNVLG-GPN-----------