[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF55333.1

[Show Plain Result]


## Summary of Sequence Search
    1::499
    6::209     2e-45  46%  247 aa  PF00743 FMO-like "Flavin-binding monooxygenase-like"
    3::167     2e-04  32%  275 aa  PF07992 Pyr_redox_2 "Pyridine nucleotide-disulphide oxidoreductase"
    1::499

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxVIVGSGFAGLGMGAQLKRRGDHDFVIIERADDVGGTWRDNTYPGAACDVPSHLYSFSFH
PF00743         ------------IIGAGPSGLAAAKRLLEEG-LDPVVFEKADDIGGTWR---YPSLRTNVPKELYSFSDF
PF07992         -----------VIIGGGPAGLAAALRLARAG-LKVTLIEREPGGGGLNRGG--------IPSK-------


                         .         .         *         .         .         .         .:140
query           PNPNWSQVFSPGPEIQTYLQNFAQDEGLLPHLHFNRNMNNARWDEKEGRWHITTPGQVYIAQFLITGTGH
PF00743         PFPEDYPNFPPHPEILDYLEDYADKFGLRKHIRFNTKVVSAEWDEETGKWTVTTERETEVFDAVVVATGH
PF07992         PLLKAAEV----GELDLRLLEQAKDRGVEVLLG-----GEVTGIDPEGKTVTLADGETIEADAVVLATG-


                         +         .         .         .         .         *         .:210
query           LADESYPTIPGLESFTGEKFHSARWDHNVSLKGKRIGVVGTGASAIQIVPEMAKIASELVVFQRTPSYII
PF00743         YSYPNIPEIPGLEDFKGKVFHSADWRHPEDLKGKRVVVIGSGASAIDIAPELAKVAAHVTMSQRSPTWVL
PF07992         -ARPRIPPIPG-EELPGVGVLTS--DDALELRGKRVVVVGGGNTGLELAGALARLGAEVTVVER------


                         .         .         .         +         .         .         .:280
query           PRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00743         PR--------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00743         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00743         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00743         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxx
PF00743         ---------
PF07992         ---------