[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF55378.1

[Show Plain Result]


## Summary of Sequence Search
    1::366
   20::106     2e-12  45%  128 aa  PF00107 ADH_zinc_N "Zinc-binding dehydrogenase"
    1::366

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00107         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00107         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00107         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxVDIHNSRLEMAKELGATHTINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTV
PF00107         -----VDRSPEKLELAKELGADHVINYKDEDFVEAVKELTGGGVDVVLDCVGSGATLEAALELLRPGGRV


                         .         *         .         .         .         .         +:350
query           GLVGAPAPGAEATFEVGASLVRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00107         VLVGVPS-GGPVTLPLGPLILK------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxx
PF00107         ----------------