[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF55431.1

[Show Plain Result]


## Summary of Sequence Search
    1::100
   10::76      1e-09  36%   76 aa  PF02617 ClpS "ATP-dependent Clp protease adaptor protein ClpS"
    1::100

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVWDDPVNLMSYVTYVFQTVLGFSKKRATELMMQVHTEGKA
PF02617         -----------------------------VLLNDDYHTMEFVIEVLQKVFGCSEEQATQIMLEVHREGRA


                         .         .         *         .         .         .         .:140
query           VVSSGEKDKVEGDVKKLHTAGLWATMxxxx
PF02617         VVGVGTREIAETKVEQVQRYGLLCTI----