[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF55672.1

[Show Plain Result]


## Summary of Sequence Search
    1::455
    2::166     3e-07  36%  275 aa  PF07992 Pyr_redox_2 "Pyridine nucleotide-disulphide oxidoreductase"
    4::200     8e-06  33%  247 aa  PF00743 FMO-like "Flavin-binding monooxygenase-like"
    1::455

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxVAVVGAGPAGIYASDLLMKSDTDVQIDLFERMPAPFGLIRYGVAPDHPRIKGIVKSLHNVMDKE
PF07992         ------VVIIGGGPAGLAAALRLARAG--LKVTLIEREPGGGGLNRGGI-PSKPLLKAALRLLEQAKDRG
PF00743         ------VAIIGAGPSGLAAAKRLLEEGLDPVV--FEKADDIGGTWRYPSLPNFPPHPEILDYLEDYADKK


                         .         .         *         .         .         .         .:140
query           QLRFLGNIEVGKDITVEELREFYDAIVFSTGATGDQDLRVPGSDLEGSWGAGEFVGFYDGNPNFERNWDL
PF07992         VEVLLGG-EVGKTVTLADGETIEDAVVLATGARP-RIPPIPGEELPG-------VGVLTSDDALELRG--
PF00743         HIRFNTKVETGKTVTTEEETEVFDAVVVATGHYSYPNIPIPGLE--------DFKGKVFHSADWRHPEDL


                         +         .         .         .         .         *         .:210
query           SAEKVAVVGVGNVALDVARILAKTGDELLVTExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07992         KPKRVVVVGGGNTGLELAGALARLGAEVTVVE--------------------------------------
PF00743         KGKRVVVIGSGASAIDIAPELAKVAAHVTMSQ--------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07992         ----------------------------------------------------------------------
PF00743         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07992         ----------------------------------------------------------------------
PF00743         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07992         ----------------------------------------------------------------------
PF00743         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07992         -----------------------------------
PF00743         -----------------------------------