[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF55698.1

[Show Plain Result]


## Summary of Sequence Search
    1::266
   12::171     1e-07  34%  171 aa  PF00795 CN_hydrolase "Carbon-nitrogen hydrolase"
    1::266

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGEFSTAVKELA
PF00795         ----------------NLAKILELIREAARQGADLVVFPELALPGYGALALLELAEALPGPALAALAAAA


                         .         .         *         .         .         .         .:140
query           DELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQGYNKIHTYDAFGYRESDTVKPGDELVVFE
PF00795         REAGVPLLVG------APERDGGGL--YNSAVVIDPDGEILGYDKRHLVPFGEYPERRYFGPGGSLPVFD


                         +         .         .         .         .         *         .:210
query           VDDIKFGVATCYDIRFPEQFKDLARNDAQVILVPTSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00795         VGGGRIGVLICYELAFPELVRALAAAGAEILVNPSN----------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00795         --------------------------------------------------------