[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF55908.1

[Show Plain Result]


## Summary of Sequence Search
    1::165
    1::137     6e-09  28%  141 aa  PF00210 Ferritin "Ferritin-like domain"
    1::165

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxIDGLQERLTDYNDLHLILKHVHWNVTGPNFIAVHEMLDPQVDLVRGYADEVAE
PF00210         -----------------VEALNEQLADELTASYQYLNMHWYFKGVGFPGLAKFFDEQADEEREHADKLAE


                         .         .         *         .         .         .         .:140
query           RISTLGGAPVGTPEGHVADRTPLQYERNAGNAQAHLTDLNRVYTQVLTGVRESMASAGPVDPVTEDIYIG
PF00210         RILMLGGTPNLTRAELLDISKPEEEWGSVLEALEAALELEKEVTQELRELIKLAEEEG--DPVTADFLEE


                         +         .         .         .         .         *         .:210
query           QAAELEKFQWFIRAHIxxxxxxxxx
PF00210         ILEEQEEHIWMLEAYL---------