[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF52967.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dc1A.bssp"
#ERROR : Can't open dsspfile "1jmmA.bssp"
#ERROR : Can't open dsspfile "1bgwA.bssp"
#ERROR : Can't open dsspfile "1ei1A1.bssp"
#ERROR : Can't open dsspfile "1s16A1.bssp"
#ERROR : Can't open dsspfile "1i82A.bssp"
#ERROR : Can't open dsspfile "1j6rA.bssp"
#ERROR : Can't open dsspfile "2j0nA1.bssp"
#ERROR : Can't open dsspfile "1eq6A.bssp"
#ERROR : Can't open dsspfile "1pvgA2.bssp"
#ERROR : Can't open dsspfile "2ox7A1.bssp"
#ERROR : Can't open dsspfile "1vddA.bssp"
#ERROR : Can't open dsspfile "1ignA2.bssp"
#ERROR : Can't open dsspfile "1q67A.bssp"
#ERROR : Can't open dsspfile "1pyyA3.bssp"
#ERROR : Can't open dsspfile "1t6t1.bssp"
#ERROR : Can't open dsspfile "1mu5A3.bssp"
#ERROR : Can't open dsspfile "1ybeA1.bssp"
#ERROR : Can't open dsspfile "1pvgA1.bssp"
#ERROR : Can't open dsspfile "1aj6A.bssp"
#ERROR : Can't open dsspfile "1kl9A1.bssp"
#ERROR : Can't open dsspfile "1bknA2.bssp"
#ERROR : Can't open dsspfile "1ys3A1.bssp"
#ERROR : Can't open dsspfile "1a4hA.bssp"

## Summary of PDB Search
:684
    7e-88  13%  1dc1A  [c.52.1.11] BSOBI RESTRICTION ENDONUCLEASE
    2e-86  12%  1jmmA  [b.30.6.1] PROTEIN I/II V-REGION
    2e-66  29%  1bgwA  [e.11.1.1] TOPOISOMERASE
    2e-65  46%  1ei1A1 [d.14.1.3] DNA GYRASE B A:221 -- 392
    2e-59  28%  1s16A1 [d.14.1.3] TOPOISOMERASE IV SUBUNIT B A:1217 -- 1383
    5e-45  10%  1i82A  [b.1.9.2] ENDO-1,4-BETA-XYLANASE A
    6e-40  12%  1j6rA  [d.173.1.2] METHIONINE SYNTHASE
    5e-33  13%  2j0nA1 [a.250.1.1] INVASIN IPAD A:144 -- 314
    6e-33  14%  1eq6A  [d.107.1.1] MOG1P
    5e-31  20%  1pvgA2 [d.122.1.2] DNA TOPOISOMERASE II A:7 -- 245
    4e-29   6%  2ox7A1 [b.172.1.1] HYPOTHETICAL PROTEIN A:3 -- 145
    5e-25  15%  1vddA  [e.49.1.1] RECOMBINATION PROTEIN RECR
    9e-25  14%  1ignA2 [a.4.1.6] PROTEIN (RAP1) A:446 -- 594
    2e-24  11%  1q67A  [b.55.1.7] DECAPPING PROTEIN INVOLVED IN MRNA DEGRADATION-
    2e-22  23%  1pyyA3 [d.175.1.1] PENICILLIN-BINDING PROTEIN 2X A:73 -- 263
    3e-22  20%  1t6t1  [c.136.1.1] PUTATIVE PROTEIN
    8e-20  12%  1mu5A3 [d.122.1.2] TYPE II DNA TOPOISOMERASE VI SUBUNIT B A:10 --
    8e-19  19%  1ybeA1 [c.1.17.2] NICOTINATE PHOSPHORIBOSYLTRANSFERASE A:168 -- 433
    4e-18  22%  1pvgA1 [d.14.1.3] DNA TOPOISOMERASE II A:246 -- 406
    3e-17  42%  1aj6A  [d.122.1.2] GYRASE
    3e-13  17%  1kl9A1 [a.60.14.1] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 A:89
    3e-09  18%  1bknA2 [d.122.1.2] MUTL A:20 -- 216
    1e-04  16%  1ys3A1 [d.122.1.3] SENSOR-TYPE HISTIDINE KINASE PRRB A:299 -- 446
    2e-04  20%  1a4hA  [d.122.1.1] HEAT SHOCK PROTEIN 90
:684

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxNTEHNYDASSITILEGLEAVRKRPGMYIGSTGPRGLHHLIWEVVDNSVDEAMAGHATKVEVTLLEXXX
1dc1A           ----------------------------------------------------------------------
1jmmA           ----------------------------------------------------------------------
1bgwA           ----------------------------------------------------------------------
1ei1A1          ----------------------------------------------------------------------
1s16A1          ----------------------------------------------------------------------
1i82A           ----------------------------------------------------------------------
1j6rA           ------KVEIAPSEIKIPDNVLKAKLGFGGAEEIPEEFR----KTVNRAYEELLDAAKPVVLWRDFEVDG
2j0nA1          ----------------------------------------------------------------------
1eq6A           ----------------------------------------------------------------------
1pvgA2          ---------SDKYQKISQLEHILKRPDTYIGSVETPGLFKIFDEILVNAADNKVRDPSKRIDVNIHEEHT
2ox7A1          ----------------------------------------------------------------------
1vddA           ----------------------------------------------------------------------
1ignA2          ----------------------------------------------------------------------
1q67A           ----------------------------------------------------------------------
1pyyA3          ----------------------------------------------------------------------
1t6t1           ----------------------------------------------------------------------
1mu5A3          ---------------LSPAEFFKRNPELAGFPNPARALYQTVRELIENSLDATDVHG-----ILPNIKIT
1ybeA1          --TLDVLYARAKAKMWEKVERLRELPGLRISDFGTRRRHSFLWWCVEALKEGIGPAFTGTSNVLLAMDSD
1pvgA1          ----------------------------------------------------------------------
1aj6A           --------------VLKGLDAVRKRPGMYIGDTDDGTLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNS
1kl9A1          ----------------------------------------------------------------------
1bknA2          -------------------------------------PASVVKELVENSLDAG----ATRIDIDIERGGA
1ys3A1          ----------------PDLDVSLVPSPTCIIVGLPAGLRLAVDNAIANAVKHGGATLVQLSAVSSRAGVE
1a4hA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXRGIPVDMHPSGAPTVQVVMTQLHAGGKFDSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGK
1dc1A           ----------------------------------------------------------------------
1jmmA           ----------------------------------------------------------------------
1bgwA           ----------------------------------------------------------------------
1ei1A1          ----------------------------------------------------------------------
1s16A1          ----------------------------------------------------------------------
1i82A           ----------------------------------------------------------------------
1j6rA           SLSFDDMELATKHLSGSIITVFLATLGKKKIEEYFRKGEDLLAFFIDGIASEMVEYALRKVDAELRMKRS
2j0nA1          ------------------------------------------------------DINEQKVYEHAVSSYT
1eq6A           ----------------------------------------------------------------------
1pvgA2          IEVKNDGKGIPIEIHNKNIYIPEXIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADLNV
2ox7A1          ----------------------------------------------------------------------
1vddA           ----------------------------------------------------------------------
1ignA2          ----------------------------------------------------------------------
1q67A           ----------------------------------------------------------------------
1pyyA3          ----------------------------------------------------------------------
1t6t1           ----------------------------------------------------------------------
1mu5A3          IDLIDDARQIYKVNVVNGIGIPPQEVPNAFGRVLYSKYVNRQTRGMYGLGVKAAVLYSQMHQDKPIFKLK
1ybeA1          LE--------AVGTNAHELPMVVAALAQLAAAPYQVLKDWNRLYG-GNLLIVLPDAFGTAAFRNAPEWVA
1pvgA1          ----------------------------------------------------------------------
1aj6A           VSVQDDGRGIPTGIVS-----------AAEVIMTVLHAGGKFSGGLHGVGVSVVNALSQKLELVIQHEGK
1kl9A1          ----------------------------------------------------------------------
1bknA2          KLIRIRDNGCGI---KKDELALALAIASL------DDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQ
1ys3A1          IAIDDNGSGVPEGERQ------------------------------------------------------
1a4hA           ---------------------INNLGTIAKSGTKAFMEALSAGADVFGVGFYSLFLVADRVQVISKSNDD


                         +         .         .         .         .         *         .:210
query           HWYQNFEKSVPDELIEGGNARGTGTTIRFWPDAEIXXXXXXXXXXISRRLQEMAFLNKGLTITLTDNRXX
1dc1A           ----------------------------------------------------------------------
1jmmA           ----------------------------------------------------------------------
1bgwA           ----------------------------------------------------------------------
1ei1A1          ----------------------------------------------------------------------
1s16A1          ----------------------------------------------------------------------
1i82A           ---------------------------------------------IDGEIDEIWNTTEEIETKAVAMGS-
1j6rA           NLEGSFRISLNKKIAEIFKEEVDVNVIVLVPRKTI-----------------------------------
2j0nA1          QMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALEELKEKYKDKPLYPANNTVSQEQANKWLTE--
1eq6A           ----------------------------------------------------------------------
1pvgA2          GQKYVQKWECHPPKITSYKKGPSYTKVTFKPDLTRFGXKELDNDILGVXRRRVYDINRDINVYLNGKS--
2ox7A1          --FRAWDTYEKELENVTPLFDDSNSXIAIITDFQIKGSPGTSEIEIGSYDTTFNWDEFPYVIXQSTGL--
1vddA           ----------------------------------------------------------------------
1ignA2          ----------------------------------------------------------------------
1q67A           ----------------------------------------------------------------------
1pyyA3          ----------------------------------------------------------------------
1t6t1           ----------------------------------------------------------------------
1mu5A3          IDINKNEPIIVERGSVENTRGFHGTSVAISIPGDW----PKAKSRIYEYIKRTYIITPYAEFIFKDPE--
1ybeA1          DWTGFPDSAPPIEGGE------------------------------------------------------
1pvgA1          ----------------------------------------------------------------------
1aj6A           IHRQIYEHGVPQAPLVTGETEKTGTMVRFWSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKR--
1kl9A1          ----------------------------------------------------------------------
1bknA2          EAWQAYAVTVKPA------AHPVGTTLEVLDTEKTEFNH------IDEIIRRIALARFDVTINLSHNG--
1ys3A1          ----------------------------------------------------------------------
1a4hA           IWESNAGGSFTVTLDEVNERIGRGTILRLFLKDDQ------LEYLEEKRIKEVIFVAYPIQLVVTKEV--


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXXXXXXXSLDEIDNETELVEETTDAXXXXXXXXXXXIFHYPNGLEDYVQYLNRSKTNI
1dc1A           ----------------------------------------------------------------------
1jmmA           ----------------------------------------------------------------------
1bgwA           ----------------------------------------------------------------------
1ei1A1          ------------------------------------------------------GIKAFVEYLNKNKTPI
1s16A1          -----------------------------------------------------DGLNDYLAEAVNGLPTL
1i82A           -------------------LDKNATAKVR-------------------VLWDENYLYVLAIVKDPVLNKD
1j6rA           ----------------------------------------------------------------------
2j0nA1          -------------------------LGGTIGKV----------------SQKNGG---YVVSINMTP--I
1eq6A           ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
2ox7A1          ----------------------------KDKNGV---------------EIFEGDILVYDAPKKYAHRRS
1vddA           ----------------------------------------------------------------------
1ignA2          ----------------------------------------------------------------------
1q67A           ----------------------------------------------------------------------
1pyyA3          -------------------------------------------------VYANKVAEVFHKYLDMEESYV
1t6t1           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1ybeA1          ----------------------------------------------------------------------
1pvgA1          ---------------------------------------------------------NFKNYVELYLKSL
1aj6A           ----------------------------------------------------------------------
1kl9A1          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           HPSIVSFEAKGDDHEVEVAMQWNSSYKESVHTFANTINTREGGTHEEGFRSALTSLMNRYAREHKLLKEK
1dc1A           -----------------------------------------------------------FEN--HLKSVD
1jmmA           ----------------------------------------------------------------------
1bgwA           ----------------------------------------------------------------------
1ei1A1          HPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSKKA
1s16A1          PEKPFIGNFAGDTEAVDWALLWLPEGELLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFCEYRNILPRG
1i82A           NSNPW----EQDSVEIFIDENNHEDDDAQFRVNYMNEQTFGTGGSPARFKTAVKLIEGGYIVEAAI----
1j6rA           ----------------------------------------------------------------------
2j0nA1          DNMLKSLDNLGGNGENAKYQAWNAGFSAEDETMKNNLQT------------LVQKYSNANSIFDNLVK--
1eq6A           ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
2ox7A1          XHEIAYADGRFFWEFLDLVFCQSNILYRDGYLVIGNIHE-------------------------------
1vddA           ----------------------------------------------------------------------
1ignA2          ----------------------------------------------------------------------
1q67A           ----------------------------------------------------------------------
1pyyA3          REQLVSFGAKGNGITYANMMSPNRSYPNSFIGLAQLHENEDGSKSLLG-TSGMESSLNSILAGTDDGKDV
1t6t1           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1ybeA1          ----------------------------------------------------------------------
1pvgA1          IPTILY---ERINNRWEVAFAVSDISFQQI-SFVNSIATTXGGTHVNYITDQIVKKISEILKKVKSFQIK
1aj6A           ----------------------------------------------------------------------
1kl9A1          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EANLTGDDCREGLSAVISVRVGDPQFEGQTKTKLGNTEIKSFVQRMANEHIGHWLEANPAEAKVIINKAV
1dc1A           DLKTTYEEYRAGFIAFALEKNSTPYIERARALKVAASVAKTPKDLLYLEDIQDALLYASGISDKAKKFLT
1jmmA           ------KDLADYPVKLKAYEDEQASIKAALAELEKHKNEDGNLTEPSAQNLVYDLEPNANLSLTTDGKFL
1bgwA           ----------------------------------------------------------------------
1ei1A1          KVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKII
1s16A1          V-KLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFILWLNQNVQAAELLAEMAI
1i82A           --KWKTIKPTPNTVIGFNIQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLI--------------
1j6rA           ----------------------------------------------------------------------
2j0nA1          ----------------------------------------------------------------------
1eq6A           ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
2ox7A1          ----------------------------------------------------------------------
1vddA           ------------------------------------------------VSLIRELSRLPGIGPKS-----
1ignA2          ----------------------------------------------------------------------
1q67A           ----------------------------------------------------------------------
1pyyA3          Y---------------------------------------------------------------------
1t6t1           ----------------------------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1ybeA1          ----------------------------------------------------------------------
1pvgA1          NNXF----------IFINCLIENPAFTSQTKEQLTT----------------------------------
1aj6A           ----------------------------------------------------------------------
1kl9A1          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GSAQARLAARKARDLVRRKSATDLGGLPGKLADCRSKDPEKSELYIVEGDSAGGSAKSGRDSMFQAILPL
1dc1A           ----------EDDKKESINNLIEN---FLEPAGEEFIDELIFRYLLFQGDSLGGTMRNAQQKLTRAIISA
1jmmA           KASAVDDAFSKSTSKAKVQKILQLDDLDITNLEQSNDVASSXELYGNFGDKAGWSTTVSNNSQWGSVLLE
1bgwA           -----------------RKSRITN---YPKLEDAGTKEGYKCTLVLTEGDSAAGLAVVGRD--YYGCYPL
1ei1A1          DAARAREAARRAREM-------------------------------------------------------
1s16A1          SSAQRRMRA-------------------------------------------------------------
1i82A           ----------------------------------------------------------------------
1j6rA           ----------------------------------------------------------------------
2j0nA1          ----------------------------------------------------------------------
1eq6A           ----------------------------------------------------------------------
1pvgA2          ----------------------------------------------------------------------
2ox7A1          ----------------------------------------------------------------------
1vddA           --------AQRLAFHLFEQPREDIERLASALLEAKRDLHVPICFNITDAEKCDVCADPSRDQRTICVVEE
1ignA2          ----------------------------------------------------------------------
1q67A           ---------------------------------------------------------------DPKIKQL
1pyyA3          ----------------------------------------------------------------------
1t6t1           -----------------------------------------------------------NLSEWIKELKS
1mu5A3          ----------------------------------------------------------------------
1ybeA1          ----------------------------------------------------------------------
1pvgA1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1kl9A1          ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RGKILNVEKARLDKVLKNAEVQAIITALGTGIHDEFDINKLRYHKIVLMADADVDGQHIATLLLTLLFRF
1dc1A           LYKWLDSRDKKYTNWMDKPEDDYELETFAKGISWTIKHRTLMYNITVSLVKKNVDICLFNCEPQQPEKYL
1jmmA           RGQSATATYTNLQNYYNGKKISKIVYKYTVDPKSKFWLGIFTDPTLGVFASAYTGQVEKNTSNEFTFYDE
1bgwA           RGKMLNVREASADQILKNAEIQAIKKIMGLQHRKYEDTKSLRYGHLMIMTDQDHDGSHIKGLIINFLESS
1ei1A1          ----------------------------------------------------------------------
1s16A1          ----------------------------------------------------------------------
1i82A           ----------------------------------------------------------------------
1j6rA           ----------------------------------------------------------------------
2j0nA1          ----------------------------------------------------------------------
1eq6A           -----------------------------------------------NNKEVELYGGAITTVVPPGFIDA
1pvgA2          ----------------------------------------------------------------------
2ox7A1          ----------------------------------------------------------------------
1vddA           PGDVIALERSGEYRGLYHVLHGVLSPMNGVGPDKLIKPLLPRVGQGILATGTTVEGDATALYLQRLLEPL
1ignA2          ----------------------------------------------------------------------
1q67A           LFHTPHASLYKWD-FKKDEWNKLEYQGVLAIYLRDVSKDIYNYGLIILNRINPDNFSPNSVVNKRKVFNA
1pyyA3          ----------------------------------------------------------------------
1t6t1           REAVILVEGKNDKKALSKFSIKNVIDLSGKRYADVVDXLEGKWEKVILLFDLDTHGERINQKXKELLSSQ
1mu5A3          ----------------------------------------------------------------------
1ybeA1          ----------------------------------------------------------------------
1pvgA1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1kl9A1          --------------------------------------------------------------------KF
1bknA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           MPDLVAEGHVYLAQPPLYKLKWQRGEPGFAYSDEERDEQLNEGLAAGRKINKDDGIQRYKGLGEMNASEL
1dc1A           LLGELKGGIDPAGADEHWKTANTALT---RIRNKFSEKGLS-------PKTIFIGAAIEHSMAEEIWDQL
1jmmA           DGKPINFDNALLSVASLNREHNYSGKFVKISGSSIGEKNGXIYATDTLNFKQGEGGSRWTXYKNSQAGSG
1bgwA           FLGLLIQGFLLEFITPIIKVSITKPT-KNTIAFYNMPDYEKW--REEESHKFTWKQKYYKGLGTSLAQEV
1ei1A1          ----------------------------------------------------------------------
1s16A1          ----------------------------------------------------------------------
1i82A           ----------------------------------------------------------------------
1j6rA           ----------------------------------------------------------------------
2j0nA1          ----------------------------------------------------------------------
1eq6A           LREVPDTQEVYVNSRRDEEEFEDG-LATNESIIVDLLETVDK------SDLKEAWQFHVEDLTELNGTTK
1pvgA2          ----------------------------------------------------------------------
2ox7A1          ----------------------------------------------------------------------
1vddA           GAA-------------------------------------------------------------------
1ignA2          --KFSADEDYTLAIAVK---KQFYRDLFQIDPDTGRSLIRTQ------SRRGPIAREFFKHFAEEHAAHT
1q67A           EEDTLNPLGVEVKDELVIIKNLKHEVYGIWIHTVSD---------------RQNIYELIKYLLENEPKD-
1pyyA3          ----------------------------------------------------------------------
1t6t1           GVDENFRNFLKKWNIIHIE---------------------------------------------------
1mu5A3          ----------------------------------------------------------------------
1ybeA1          ----------------------------------------------------------------------
1pvgA1          ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1kl9A1          TKSKTVYSILHVAEVLEYTKDEQLESL-FQRTAWVFDDK-----------YKRPGYGAYDAFKHSDPSIL
1bknA2          ----------------------------------------------------------------------
1ys3A1          ----------------------------------------------------------------------
1a4hA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           WETTMDPTVRILRRVDITDAQRADELFSILMGDDVVARRSFITRNAKDVRFLDI
1dc1A           QSGSLTNSANLTKTEQVGSLCR--------------------------------
1jmmA           WDSSDAPNSWYGAGA---------------------------------------
1bgwA           REYFSNLDRHLKIFHLFSLADNIRSIPNVLDGFKPGQRKVLYGCFKKNL-----
1ei1A1          ------------------------------------------------------
1s16A1          ------------------------------------------------------
1i82A           ------------------------------------------------------
1j6rA           ------------------------------------------------------
2j0nA1          ------------------------------------------------------
1eq6A           WEALQEDTVQQGTKFTGLVMEVANKWGKPDLAQTVVIGVALIRLTQFDTDVVIS
1pvgA2          ------------------------------------------------------
2ox7A1          ------------------------------------------------------
1vddA           ------------------------------------------------------
1ignA2          ENAWRDRFRKFLLAYGIDDY--------ISYYEAEEPMKNLTPTPGN-------
1q67A           ------------------------------------------------------
1pyyA3          ------------------------------------------------------
1t6t1           ------------------------------------------------------
1mu5A3          ------------------------------------------------------
1ybeA1          ------------------------------------------------------
1pvgA1          ------------------------------------------------------
1aj6A           ------------------------------------------------------
1kl9A1          DSLDLNEDEREVLINNI-------------------------------------
1bknA2          ------------------------------------------------------
1ys3A1          ------------------------------------------------------
1a4hA           ------------------------------------------------------