[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF53115.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1tc3C.bssp"
#ERROR : Can't open dsspfile "1vz0A1.bssp"
#ERROR : Can't open dsspfile "1pdnC.bssp"

## Summary of PDB Search
:383
    6e-05  19%  1tc3C  [a.4.1.2] PROTEIN (TC3 TRANSPOSASE)
    8e-05  23%  1vz0A1 [a.4.14.1] CHROMOSOME PARTITIONING PROTEIN PARB A:116 -- 208
    2e-04  17%  1pdnC  [a.4.1.5] PROTEIN (PRD PAIRED)
:383

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRGGIYLPAQKHHPGTLTLAEREE
1tc3C           -----------------------------------------------------------GSALSDTERAQ
1vz0A1          --------------------------------------------------------------LSPVEEAG
1pdnC           -----------------------------------------------LGGVFINGRP-----LPNNIRLK


                         .         .         *         .         .         .         .:140
query           ISRGLSVGLSYRAIARLTGRSASTISREVTRNRGRTAYRAIDADDRSWRQARRPQRCKLAKNPVLRGYVA
1tc3C           LDVMKLLNVSLHEMSRKISRSRHCIRVYLKD---------------------------------------
1vz0A1          YQALLEMGLTQEEVARRVGKARSTVANALLLQLPPEALEALERGEITAGHARAL----LMLEPEDRLWGL
1pdnC           IVEMAADGIRPCVISRQLRVSHGCVSKILNR------YQETGSIRPGVIGGSKPRIATPEIENRIEEYK-


                         +         .         .         .         .         *         .:210
query           ARLREDWSPEQIAGRLKITYACTSRMQISHESIYKSLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1tc3C           ----------------------------------------------------------------------
1vz0A1          KELEKGLSVRQA----------------------------------------------------------
1pdnC           -RSSPGMFSWEIREKLIREGVCDRSTAPSVSAISRLV---------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1tc3C           ----------------------------------------------------------------------
1vz0A1          ----------------------------------------------------------------------
1pdnC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1tc3C           ----------------------------------------------------------------------
1vz0A1          ----------------------------------------------------------------------
1pdnC           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1tc3C           ---------------------------------
1vz0A1          ---------------------------------
1pdnC           ---------------------------------