[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF53610.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fjgE1.bssp"
#ERROR : Can't open dsspfile "1fjgE2.bssp"
#ERROR : Can't open dsspfile "1azpA.bssp"

## Summary of PDB Search
:211
    2e-12  52%  1fjgE1 [d.14.1.1] 30S RIBOSOMAL PROTEIN S5 E:74 -- 154
    3e-11  38%  1fjgE2 [d.50.1.2] 30S RIBOSOMAL PROTEIN S5 E:5 -- 73
    2e-08  19%  1azpA  [b.34.13.1] PROTEIN (HYPERTHERMOPHILE CHROMOSOMAL PROTEIN
:211

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSQYIERVVTINRVSKVVKGGRRFSFTALX
1fjgE1          ----------------------------------------------------------------------
1fjgE2          ---------------------------------------------EKMILIRRTARMQAGGRRFRFGALV
1azpA           -----------------------------------------YKGEEKEVDTSKIKKVWRVGKMVSFTY--


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXKAKEVPAAIQKGAEEARKNFFRVPMVNGTITHPVQGEKAAGIVMLKPAAPGTGVIA
1fjgE1          -----------------------------------------GTIPHEIEVEFGASKIVLKPAAPGTGVIA
1fjgE2          VVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQN-----------------------------
1azpA           ---DDNGKTGRGAVSEKDAPKELLDMLARAERE-------------------------------------


                         +         .         .         .         .         *         .:210
query           GGAARPVLECAGIQDILSKSLGSDNAINVVHATVDGLKQLVRPEEVAARRxxxxxxxxxxxxxxxxxxxx
1fjgE1          GAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLR--------------------
1fjgE2          ----------------------------------------------------------------------
1azpA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           x
1fjgE1          -
1fjgE2          -
1azpA           -