[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF53649.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1sb8A.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "2b69A1.bssp"
#ERROR : Can't open dsspfile "1kbzA.bssp"
#ERROR : Can't open dsspfile "1orrA.bssp"
#ERROR : Can't open dsspfile "1db3A.bssp"
#ERROR : Can't open dsspfile "1k6iA.bssp"
#ERROR : Can't open dsspfile "1vl0A.bssp"
#ERROR : Can't open dsspfile "2c54A1.bssp"
#ERROR : Can't open dsspfile "1ujmA.bssp"
#ERROR : Can't open dsspfile "1bsvA.bssp"
#ERROR : Can't open dsspfile "1aorA1.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "1u9jA.bssp"
#ERROR : Can't open dsspfile "1eq2A.bssp"
#ERROR : Can't open dsspfile "1rkxA.bssp"
#ERROR : Can't open dsspfile "1i24A.bssp"
#ERROR : Can't open dsspfile "1qycA.bssp"
#ERROR : Can't open dsspfile "1a2zA.bssp"
#ERROR : Can't open dsspfile "2a35A1.bssp"
#ERROR : Can't open dsspfile "1hdoA.bssp"
#ERROR : Can't open dsspfile "1lssA.bssp"
#ERROR : Can't open dsspfile "1pfsA.bssp"
#ERROR : Can't open dsspfile "2bkaA1.bssp"
#ERROR : Can't open dsspfile "1vm6A3.bssp"
#ERROR : Can't open dsspfile "1e5lA1.bssp"
#ERROR : Can't open dsspfile "1c3vA1.bssp"
#ERROR : Can't open dsspfile "1r4mA.bssp"
#ERROR : Can't open dsspfile "2hjsA1.bssp"
#ERROR : Can't open dsspfile "1lsuA.bssp"
#ERROR : Can't open dsspfile "2pv7A2.bssp"
#ERROR : Can't open dsspfile "1arzA1.bssp"
#ERROR : Can't open dsspfile "1brmA1.bssp"
#ERROR : Can't open dsspfile "1b8pA1.bssp"
#ERROR : Can't open dsspfile "1bw3A.bssp"
#ERROR : Can't open dsspfile "1b6rA2.bssp"
#ERROR : Can't open dsspfile "1ks9A2.bssp"
#ERROR : Can't open dsspfile "1p9oA.bssp"
#ERROR : Can't open dsspfile "1fjhA.bssp"
#ERROR : Can't open dsspfile "1xq6A.bssp"
#ERROR : Can't open dsspfile "2ib0A1.bssp"
#ERROR : Can't open dsspfile "1jvsA2.bssp"

## Summary of PDB Search
:317
    6e-62  23%  1sb8A  [c.2.1.2] WBPP
    8e-59  28%  1bxkA  [c.2.1.2] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    1e-52  50%  2b69A1 [c.2.1.2] UDP-GLUCURONATE DECARBOXYLASE 1 A:4 -- 315
    2e-36  17%  1kbzA  [c.2.1.2] DTDP-GLUCOSE OXIDOREDUCTASE
    9e-35  24%  1orrA  [c.2.1.2] CDP-TYVELOSE-2-EPIMERASE
    9e-33  24%  1db3A  [c.2.1.2] GDP-MANNOSE 4,6-DEHYDRATASE
    4e-31   9%  1k6iA  [c.2.1.2] NMRA
    5e-30  24%  1vl0A  [c.2.1.2] DTDP-4-DEHYDRORHAMNOSE REDUCTASE, RFBD ORTHOLOG
    1e-29  21%  2c54A1 [c.2.1.2] GDP-MANNOSE-3', 5'-EPIMERASE A:13 -- 374
    4e-28  15%  1ujmA  [c.2.1.2] ALDEHYDE REDUCTASE II
    9e-27  19%  1bsvA  [c.2.1.2] PROTEIN (GDP-FUCOSE SYNTHETASE)
    4e-25   7%  1aorA1 [a.110.1.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE A:211 -- 605
    1e-24  23%  1a9yA  [c.2.1.2] UDP-GALACTOSE 4-EPIMERASE
    2e-24  20%  1u9jA  [c.2.1.2] HYPOTHETICAL PROTEIN YFBG
    3e-24  18%  1eq2A  [c.2.1.2] ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE
    1e-21  17%  1rkxA  [c.2.1.2] CDP-GLUCOSE-4,6-DEHYDRATASE
    2e-20  19%  1i24A  [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
    5e-20  13%  1qycA  [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1
    8e-20   9%  1a2zA  [c.56.4.1] PYRROLIDONE CARBOXYL PEPTIDASE
    1e-19  17%  2a35A1 [c.2.1.2] HYPOTHETICAL PROTEIN PA4017 A:4 -- 215
    1e-13  17%  1hdoA  [c.2.1.2] BILIVERDIN IX BETA REDUCTASE
    2e-13  14%  1lssA  [c.2.1.9] TRK SYSTEM POTASSIUM UPTAKE PROTEIN TRKA HOMOLOG
    1e-10   8%  1pfsA  [b.40.4.7] PF3 SINGLE-STRANDED DNA BINDING PROTEIN
    1e-10  12%  2bkaA1 [c.2.1.2] TAT-INTERACTING PROTEIN TIP30 A:5 -- 236
    4e-10  14%  1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 --
    5e-10  11%  1e5lA1 [c.2.1.3] SACCHAROPINE REDUCTASE A:2 -- 124 A:392 -- 450
    6e-10  12%  1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
    9e-10  10%  1r4mA  [c.111.1.2] AMYLOID BETA PRECURSOR PROTEIN-BINDING PROTEIN 1
    2e-09  17%  2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
    2e-09  12%  1lsuA  [c.2.1.9] CONSERVED HYPOTHETICAL PROTEIN YUAA
    3e-08  10%  2pv7A2 [c.2.1.6] T-PROTEIN [INCLUDES: CHORISMATE MUTASE (EC A:92 --
    9e-08  10%  1arzA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:4 -- 130 A:241 --
    2e-07   9%  1brmA1 [c.2.1.3] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE A:1 -- 133
    7e-06  12%  1b8pA1 [c.2.1.5] PROTEIN (MALATE DEHYDROGENASE) A:3 -- 158
    3e-05   7%  1bw3A  [b.52.1.2] BARWIN, BASIC BARLEY SEED PROTEIN
    3e-05  29%  1b6rA2 [c.30.1.1] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    8e-05  12%  1ks9A2 [c.2.1.6] 2-DEHYDROPANTOATE 2-REDUCTASE A:1 -- 167
    1e-04  23%  1p9oA  [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
    4e-04  19%  1fjhA  [c.2.1.2] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    6e-04  18%  1xq6A  [c.2.1.2] UNKNOWN PROTEIN
    8e-04   7%  2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN
    8e-04  16%  1jvsA2 [c.2.1.3] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
:317

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRCVITGGAGFLGSHLTDLILNQGHEVIVLDDLSTGSLSNLFHQISNPRLQIKTVDVRKKFEIDGPVDIV
1sb8A           -VWLITGVAGFIGSNLLETLLKLDQKVVGLDNFATGHQRNLVSEKQWSNFKFIQGDIRNLDDCNNACDYV
1bxkA           -KILITGGAGFIGSALVRYIINETSDAVVVVDKLTGNLMSLAPVAQSERFAFEKVDICDRAELARQPDCV
2b69A1          -RILITGGAGFVGSHLTDKLXXDGHEVTVVDNFFTGRKRNVEHWIGHENFEL--INHDVVEPLYIEVDQI
1kbzA           MNILLFGKTGQVGWELQRSLAPVGNLIALDV----------HSKEFCGDFSNPKGVAETVRKLR--PDVI
1orrA           -KLLITGGCGFLGSNLASFALSQGIDLIVFDNLSRKGTDNLHWLSSLGNFEFVHGDIRNKNDVTRLITKY
1db3A           -VALITGVTGQDGSYLAEFLLEKGYEVHGIKRPKFHLHYGDLSDTSNLTRILREVQPDEVYNLGAMSHV-
1k6iA           KTIAVVNATGRQAASLIRVAAAVGHHVRAQVHSLKGL----------IAEELQAIPNVTLFQGPLLNNVP
1vl0A           -KILITGANGQLGREIQKQLKGKNVEVIPT-DVQDLDITNV-------------LAVNKFFNEKKP-NVV
2c54A1          LKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENCLKVTEGVDHVFN
1ujmA           -LVLVTGANGFVASHVVEQLLEHGYKVRGTARSASK-LANLQKRWDAKYPGRFETAVVEDXLKQGAYDEV
1bsvA           -RVFIAGHRGMVGSAIRRQLEQRGDV-------------ELVLRTRDELNLLDSRAVHDFFASERIDQVY
1aorA1          -TGVYPYAYEQSGEAMAAKYLVRNKPCYACPIGCGRVNRLPTVGETEGPEYESVWALGANLNDLASIIEA
1a9yA           MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALHAIDTV
1u9jA           -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFFVEGDISIHSEWIEYHVKKCDVV
1eq2A           ---IVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLNIADYMDKEDFLIQIMAEEFGDVE
1rkxA           -RVFVTGHTGFKGGWLSLWLQTMGATVKGYSLTAPTVPSLFETARVADGMQSEIGNKLLESIREFQPEIV
1i24A           -RVMVIGGDGYCGWATALHLSKKNYEVCIVISRWKALTGKSIELYVGDICDFEFLAESFKSFEPDSVVHF
1qycA           SRILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASGANDHASLVEAVKNVDVV
1a2zA           KKVLITGFEPFGGDSKNPTEQIAKYFDRKQIGNAMVYGRVLPVSV--KRATIELKRYLEEIKPEIVINLG
2a35A1          KRVLLAGATGLTGEHLLDRILSEPTLAKVIA--------PARKALAEHPRLDNPVGPLAELLPQLDGSID
1hdoA           KKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSSR-----LPSEGPRPAHVVVGDVLQAADVDAGQDAV
1lssA           MY-IIIAGIGRVGYTLAKSLSEKGHDIVLIDIDKDICKKASALVINGDCTKIKTLEDAGIEDADMYIAVT
1pfsA           ----------------------------------------------------------------------
2bkaA1          KSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVG
1vm6A3          MKYGIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGVEELD-SPDVVIDFSSPEALPKTVDLCKKYRAGLV
1e5lA1          ---VLMLGSGFVTRPTLDVLTDSGIKVTVACRTLESAKKLSAGVQHSTPISLDVNDDAALDAEVAKHDLV
1c3vA1          MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAV
1r4mA           -HVCLIN-ATATGTEILKNLVLPGIGSFTIIDGNQVSGEDFFLQRSSIGKNRAEAAMEFLQELNSDVSGS
2hjsA1          LNVAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQRXGFAESSLRVGDVDSFDFSS----VGLA
1lsuA           -QFAVIG-LGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVI
2pv7A2          ---VIVGGYGKLGGLFARYLRASGYPISILDREDWAVAESILANADVVIVSVPINLTLIERLKPYLTENX
1arzA1          IRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGDAGELAGAGKTGVTVQSSLDAVKDDFDVF
1brmA1          KNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDLEALKALDINEI
1b8pA1          MRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLQGVMMEIDDCAFPLLAGMTAHADPMTAFKDADVA
1bw3A           ---PAQNNWDLGAPAVSAYCATWDASKPLSWSKYGWTAFCGPAGPRGQAACGKCLRVTNPATGAGGLDLD
1b6rA2          MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVG---------------------------------------
1ks9A2          MKTVL--GCGALGQLWLTALCKQGHEVQGWLR-VPQPYCSVNLVETDGSIFNESLTA-NDPDFLATSDLL
1p9oA           VRFLDNFSSGRRGATSAEAFLAAGYGVLFLY---------------------------------------
1fjhA           ---VISGCATGIGAATRKVLEAAGHQIVGIDIRDAEVIADLSTAEGRKQA---IADVLAKC--SKGMDGL
1xq6A           ----VTGASGRTGQIVYKKLKEGSDKFVAKG----LVRSAQGKEKIGGEADVFIGDITDADSINQGIDAL
2ib0A1          ---GYGIVSALSPPGVNFLVADALKQHRHRRD--------------------------------------
1jvsA2          -QLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRXVEQC-------------------------


                         .         .         *         .         .         .         .:140
query           FNLASPASPPVYTQRRVECLLINSEAVLQVAEFALEKGARLVQASTSEVYGDPLSHPQLEHHWGNVNPIG
1sb8A           LHQAALGSVPRSINDPITSNATNIDGFLNMLIAARDAKVSFTYAASSSTYGDHPGLPKVEDT-----IGK
1bxkA           MHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNRFHHISTDEVYGDLHSTDDF---FTETTPYA
2b69A1          YHLASPASPPNYXYNPIKTLKTNTIGTLNXLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIG
1kbzA           VNAAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETDATS-----
1orrA           MHLAGQVAMTTSIDNPCMDFEINVGGTLNLLEAVRQYNSNIIYSSTNKVYGDLEQYKYNETETRYTCQLD
1db3A           --AVSFESPEYTADVDAMGTLRLLEAIR---FLGLEKKTRFYQASTSELYGLVQEIPQKETT-----PFY
1k6iA           LMDTLFEGAHLAFINTTSQAGDEIAIGKDLADAAKRAGTIQH-------------YIYSSMPDHSLYGPW
1vl0A           INCAAHTAVDKCEEQYDLAYKINAIGPKNLAAAAYSVGAEIVQISTDYVFDGEAKEPITEFD--EVNP--
2c54A1          LAADMGGMGFIQSNHIMYNNTMISFNMIEAARINGIKR--FFYASSACIYPEFKQLETTNVSESDAWPAE
1ujmA           IKGAAGVAHIASVVSFSNKVTPAIGGTLNALRAAAATPSRFVLTSSTVSALIPKPNVELDEKSWNLESID
1bsvA           LAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVKLLFLGSSCIYPKLAKQPMAESELLQGTLEP
1aorA1          NHMCDELGLDTISTGGTLATAMELYEKGHIKDEELGDAPPFRWGNTEVLHYYIEKIAKREGFGDKLAEGR
1a9yA           IHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFISSAATVYGDQPKIPYVESFPTGTP---
1u9jA           LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYCSDKYFDEDHSNLIVGPVNK
1eq2A           AIFHEGAXSSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSDFIESREYEKPLN--
1rkxA           FHMAAQPLVRLSYSEPVETYSTNVMGTVYLLEAIRHVGGVVVNITSDKCYDNKEWIWGYRENEAMGG---
1i24A           GEQRSAPYSMIDRSRAVYTQHNNVIGTLNVLFAIKEFECHLVKLGTMGEYGTPNIDIEEGYITITHNPKQ
1qycA           ISTVGSLQIESQVNIIKAIKEVGTVKRF------------------------------FPSEFGNDVDNV
1a2zA           LAPTYSNITVERIAVNIIDARIPDNDGYQPIDEKIEEDAPLAMATLPVRAITKTLRDNGIPATI------
2a35A1          TAFCCLGTTIKEAGSEEAFRAVDFDLPLAVGKRALEMGAHYLVVSALGADAKS-----------------
1hdoA           IVLLGTRNDLSPTTVMSEGARN----IVAAMKAH--GVDKVVACTSAFLLWDPTKVPPRLQAVTDD----
1lssA           GKEEVNLMSSLLAKSYGINKTIARISEIEYKDVFERLGVVVVSPELIAANYIE-----------------
1pfsA           ----------------------------------------------------------------------
2bkaA1          FCCLGTTRGKAGAEGFVRVDRDYVLK--------------SAELAKAGGCKHFNLLSSKGADKSSNFLYL
1vm6A3          LGTTALKEEHLQMVVQAYSRTVFAIGALKAAEFLVGK---------------------------------
1e5lA1          ISLISAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIGYSAMAKLVGVPCAVAV--KFVLDGTISD
1c3vA1          VGTTGFTAERFQQVESWLVAKPNTSVLIAPNFTSFVPGVLAVRRI-------------------------
1r4mA           FNLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNA
2hjsA1          FFAAAAEVSRAHAER-------------------------------------------------------
1lsuA           VAIGANIQASTLTTLLLKELIWVKAQNYYHHKVLEKIGARIIHPEKDMGVKIAQSLS-------------
2pv7A2          LLADLTSVKREPLAKXLEVHTGAVLGLHPXFGADIASXAKQV--VVRCDGRF-------PERYEWLLEQI
1arzA1          IDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAG-KQAIRDAAADIAIVFA------------ANFSMTF
1brmA1          YPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITGLNNGIRTFVGGAAEPLRRMLR---------
1b8pA1          LLVGARPRGPG--MERKDLLEANAQIFTVQGKAIDAVARNIKVLVVGNPANTNAYIAMKSA---------
1bw3A           WDTVFTKIDTNGIGYQQGHLNVN-----------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1ks9A2          LVTLKAWQVSDAVKSLAS--TLPVTTPILLIHNGMGTIEELQPLLMGTTTHAARRDGNVIIHNGITHIGP
1p9oA           ----------------------------------------------------------------------
1fjhA           VLCAGLGPQTKVLGNVVSVNYFGATELMDAFLPALKKGHQPAAVVISSV---------------------
1xq6A           VILTSAVPPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGVKHI-VVVGSMGGTNPDHP--------LNKLG
2ib0A1          ----------------------------------------------------------------------
1jvsA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ERSCYDEGKRFAEALLSAMRLEQGLNAGIIRIFNTYGPRMHPFDGRVISGFVRQALANEPLTVFGDGSQT
1sb8A           PLSPYAVTKYVNELYADVFSRCYGFSTIGLRYFNVFGRRQDPAYAAVIPKWTSSMIQGDDVYINGDGETS
1bxkA           PSSPYSASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFP--EKLIPLMILNALAGKSLPVYGNGQQI
2b69A1          PRACYDEGKRVAETXCYAYXKQEGVEVRVARIFNTFGPRXHXNDGRVVSNFILQALQGEPLTVYGSGSQT
1kbzA           PLNVYGKTKLAGEKALQDN----CPKHLIFRTSWVYAGKGNNF----AKTMLRLAKERQTLSVINDQAPT
1orrA           FHSPYGCSKGAADQYMLDYARIFGLNTVVFRHSSMYGGRQATYDQGWVGWFCQKAVEIKPFTISGNGKQV
1db3A           PRSPYAVAKLYAYWITVNYRESYGMYACNGILFNHESPRRGEFVTRKITRAIANIAQGLESCLYGNMDSL
1k6iA           PAVPMWAPKFTVENYV----RQLGLPSTFVYAGIYNNNFTSLPY--PLFQMELMPDGTFEWHAPFDPDIP
1vl0A           -QSAYGKTKLEGENFVKAL----NPKYYIVRTAWLYGDGNN-----FVKTXINLGKTHDELKVVHD--QV
2c54A1          PQDAYGLERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGRPAAFCRKAQTSTDRFEMWGDGLQT
1ujmA           KAKTLPESKTEAELAAWKFXDENKPHFNAVLPNYTIGTIFDPETQSGSTSGWXXSLFNGEVSPALALXPP
1bsvA           TNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHFHPSNSHVIPALLRRAQNAPDVVVWGSGTPM
1aorA1          LAESYGHPELSMTVKKLELPAYDATNNRGGCHIKNYMIS-----PEILGYPYKMDPHDVSDDKIKMLILF
1a9yA           -QSPFGKSKLMVEQILTDLQKAQDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLAIFGNDYPTEDGTGV
1u9jA           PRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPAARIGSSRAITQLILNLVEGSPIKLIDGGKQK
1eq2A           ---VYGYSKFLFDEYVRQILPEANSQIVGFRYFNVYGPREGH----------KGSMASVAFHLNTQLNNK
1rkxA           -YDPYSNSKGCAELVTSSYRNSFFNAVATVRAGNVIGGGDWALDRIVP--DILRAFEQSQPVIIRNPHAI
1i24A           ASSFYHLSKVHDSHNIAFTCKAWGIRATDLNQGVVYGVKTDETEMHELNRFCVQAAVGHPLTVYGKGGQT
1qycA           HAVEPAKSVFEVKAKVRRAIEAEGIPYTYVSSNCFAGYFLRS-----LAQAGLTAPPRDKVVILGDGNAR
1a2zA           ----------------SYSAGTYLCNYVMFKTLHFSKIEGYPL---KAGFIHVPYTPDQVVNKFFLLGKN
2a35A1          -SIFYNRVKGELEQALQEQG---WPQLTIARPSLLFGPREEFRLAE----ILAAPIAGKYHGIEAEEGKG
1hdoA           --------HIRMHKVL----RESGLKYVAVMPPHIGDQPLTG-----------------AYTVTLDGRGP
1lssA           ----------------------------------------------------------------------
1pfsA           ----------------------------------------------IQITFTDSVR-------QGTSAKG
2bkaA1          QVKGEVEA---------KVEELKFDRYSVFRPGVLLCDRQESRPGE--------WLVRKFFGSLPDSWAS
1vm6A3          ----------------------------------------------------------------------
1e5lA1          RGVLAPMNSKINDPLMKELKEKYGIECKEKVV--------------------------------------
1c3vA1          ----------------------------------------------------------------------
1r4mA           LEDLRLDKPFPELREHFQSY-DHSHTPWIVIIAKYLAQTYKEKEDFRDLIRQGILKPEDEENFEEAIKNV
2hjsA1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
2pv7A2          QIW----GAKIYQ---------------------------------------------------------
1arzA1          ANGAVRSALWLSGKESGLFD-----MRDVLDL--------------------------------------
1brmA1          ----------------------------------------------------------------------
1b8pA1          ----------------------------------------------------------------------
1bw3A           ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1ks9A2          ARQQDGDYSYLADIL-------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1fjhA           ----------------------------------------------------------------------
1xq6A           NGNILVW-KRKAEQYL----ADSGTPYTIIR---------------------------------------
2ib0A1          ----------------------------------------------------------------------
1jvsA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RSFCYVSDLVRGLWLMGNSNQPGPINLGNPIEQTVLSMAHLIKESTNSESSITFEPLPSDDPVRRRPDIS
1sb8A           RDFCYIENTVQANLLAATAGLDARYNIAVGGRTSLNQLFFALRDGVSYHREPVYRDFREGDVRHSLADIS
1bxkA           RDWLYVEDHARALYCVATTGKVGETNIGGHNERKNLDVVETICELLEPNKPHGVAHYRDLITFRYAIDAS
2b69A1          RAFQYVSDLVNGLVALXNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIK
1kbzA           GAELLADCTAHAIRVALNKPEVALYHLVAGGTTTWHDYAALVFDEARKAGITLALTTPASRPGNSRLNTE
1orrA           RDVLHAEDMISLYFTALANVSKIRIGGTIVNSLSLLELFKLLEDYCNIDMRFTNLPVRESDQRVFVADIK
1db3A           RDWGHAKDYVKMQWMMLQQEQPEDFVIATGVQYSVRQFVEMAAAQLGIKLRFEGTGVEEKGIVVSVTDPT
1k6iA           LPWLDAEHDVGPALLQIFKDGPQKRIALTFETLSPVQVCAAFSRALNRRVTYVQVPKVEIKVNIPVGSRV
1vl0A           GTPTSTVDLARVVLKVIDEKNYGTFHCTCKGICSWYDFAVEIFRLTGIDVKV--TPCTTEEFPRKRPRNY
2c54A1          RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIP-GPEGVRGRNSDNN
1ujmA           QYYVSAVDIGLLHLGCLVLPQIRRRVYGTAGTFDWNTVLATFRKLYPSKTFPAFPDQGQDLSKFDTAPSL
1bsvA           REFLHVDDMAAASIHVNTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVT
1aorA1          QDLTALIDSAGLCLFTTFGLGADLLNAALGWDFTTEDYLKIGERIWNAERLFNLKAGLRDDTLPKRFLEE
1a9yA           RDYIHVMDLADGHVVAMEKLANKPGNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADAS
1u9jA           RCFTDIRDGIEALYRIIENAGNRCDIGNPENEASIEELGEMLLASFEKHFPPFAGFRVVESVEHRKPSIR
1eq2A           RDFVYVGDVADVNLWFLENGVSGIFNLGTGRAESFQAVADATYQ------------------AFTQADLT
1rkxA           RPWQHVLEPLSGYLLLAQKLYTDGAEPNDADATPVKNIVEQMVKYWG------EGASWQLEAHYLKLDCS
1i24A           RGYLDIRDTVQCVEIAIANPAKARVFNQFTEQFSVNELASLVTKAGSKLKMTVPNPRVEAEEHYYNAKHT
1qycA           VVFVKEEDIGTFTIKAVDDPRTLNYLRLPANTLSLNELVALWEKKIDKTLEKAYVP---------EEEVL
1a2zA           TPSMCLEAEIKAIELAVKVSLDYLEKDRDDI---------------------------------------
2a35A1          VRFVESDELRK-----------------------------------------------------------
1hdoA           SRVISKHDLGHFLRCLTTDEYDGSTYPSH-----------------------------------------
1lssA           ----------------------------------------------------------------------
1pfsA           NPYTFQEGFLHLEDKPHPLQCQFFINVNNGRPELAFDFKAMKR---------------------------
2bkaA1          GHSVPVVTVVRALNNVVRPRDKQMELLENK----------------------------------------
1vm6A3          ----------------------------------------------------------------------
1e5lA1          ----------------------------------------------------------------------
1c3vA1          ----------------------------------------------------------------------
1r4mA           NTALNTTQIPSSI---------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
2pv7A2          ----------------------------------------------------------------------
1arzA1          ----------------------------------------------------------------------
1brmA1          ----------------------------------------------------------------------
1b8pA1          ----------------------------------------------------------------------
1bw3A           ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1fjhA           ----------------------------------------------------------------------
1xq6A           ----------------------------------------------------------------------
2ib0A1          ----------------------------------------------------------------------
1jvsA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAKELLGWEPLVGIDVGLREVINWQIETQRTYAEKIS
1sb8A           KAAKLLGYAPKYDVSAGVALAMPWYIM----------
1bxkA           KIARELGCVPQETFESGMRKTVQWYLANE--------
2b69A1          KAKLXLGWEPVVPLEEGLNKAIHYFRKELEYQA----
1kbzA           KFQRNFDLIL-PQWELGVKRMLTEMFTT---------
1orrA           KITNAIDWSPKVSAKDGVQKMYDWT------------
1db3A           KAHEKLGWKPEITLREMVSEMVANDLEAAKKHS----
1k6iA           TDEARKLWSGWRDMEEYAREVFPIEEEANG-------
1vl0A           XLELTTGWKE------SLKEYID--------------
2c54A1          LIKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGS
1ujmA           EILKSLGRPGWRSIEESIKDLVGS-------------
1bsvA           RLHQ-LGWYHEISLEAGLASTYQWFLENQDRF-----
1aorA1          PMPEGPNKGHTVRLKEMLPRYYKLRGWTEDGKKEKL-
1a9yA           KADRELNWRVTRTLDEMAQDTWHWQSR----------
1u9jA           NAHRCLDWEPKIDMQETIDETLDFFLR----------
1eq2A           NLRAAGYDKPFKTVAEGVTEYMAW-------------
1rkxA           KAKMQLGWHPRWNLNTTLEYIVGWH------------
1i24A           KLME-LGLEPHYLSDSLLDSLLNFAVQFKDRVDTK--
1qycA           KLIADTPFPANISIAISHSIFVKG-------------
1a2zA           -------------------------------------
2a35A1          -------------------------------------
1hdoA           -------------------------------------
1lssA           -------------------------------------
1pfsA           -------------------------------------
2bkaA1          -------------------------------------
1vm6A3          -------------------------------------
1e5lA1          -------------------------------------
1c3vA1          -------------------------------------
1r4mA           -------------------------------------
2hjsA1          -------------------------------------
1lsuA           -------------------------------------
2pv7A2          -------------------------------------
1arzA1          -------------------------------------
1brmA1          -------------------------------------
1b8pA1          -------------------------------------
1bw3A           -------------------------------------
1b6rA2          -------------------------------------
1ks9A2          -------------------------------------
1p9oA           -------------------------------------
1fjhA           -------------------------------------
1xq6A           -------------------------------------
2ib0A1          -------------------------------------
1jvsA2          -------------------------------------