[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF53734.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1v2xA.bssp"
#ERROR : Can't open dsspfile "1j85A.bssp"
#ERROR : Can't open dsspfile "1gz0A1.bssp"
#ERROR : Can't open dsspfile "1ipaA1.bssp"
#ERROR : Can't open dsspfile "1gqiA2.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1z67A1.bssp"

## Summary of PDB Search
:157
    3e-32  28%  1v2xA  [c.116.1.1] TRNA (GM18) METHYLTRANSFERASE
    3e-29  45%  1j85A  [c.116.1.1] YIBK
    4e-28  18%  1gz0A1 [c.116.1.1] HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE YJFH
    1e-20  23%  1ipaA1 [c.116.1.1] RNA 2'-O-RIBOSE METHYLTRANSFERASE A:106 -- 263
    3e-20  10%  1gqiA2 [d.92.2.2] ALPHA-GLUCURONIDASE A:5 -- 151
    1e-11  12%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    3e-06  11%  1z67A1 [a.259.1.1] HYPOTHETICAL PROTEIN S4005 A:3 -- 131
:157

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxEHPLHVIFDNPVIPPNTGNAIRMCAGTGAHLHLVEPLGFELTEKHLRRAGLDYHDLADVTVHATFDEA
1v2xA           --QPDLTVLLENVHKPHNLSAILRTCDAVGVEAHAVNPTGGVPT---FNETSGGSHKWVYLRVHPDLHEA
1j85A           -----LDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAF
1gz0A1          --DQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLART
1ipaA1          --PDALILVAVGLEKPGNLGAVLRSADAAGAEAVLVAG-GVDLYSPQVIRNSTGVVFSLRTLAASESEVL
1gqiA2          ---KTYQKQIRHLHVAGD-SPTINAAAQRGLSGLLNKPIVARDEKLKDYSLVIGTPDNSPLIASLNLGER
1mjgM           ------PSGMTFSTLAGMIGGGTQTPGFMGGRTYIVSKKFISADGGIARIVWMPKSLLHDEFVRSSVEEG
1z67A1          --AGKYQAILSWVEEQGGIQVLLEKLQSGGLGAILSTWLSNQVSGEQLESAGTNAVSDLGQKLGVDTSTA


                         .         .         *         .         .         .         .:140
query           MAAVPGRVXXXXXXXXXXXXXXXFEPGDALLFGTEPTGLPQEHVEHSRITSELRIPMLPGRRSMNLSNSA
1v2xA           FRFLKERYATALREDARDFREVDYTKPTAVLFGAEKWGVSEEALALA--DGAIKIPMLGMVQSLNVSVAA
1j85A           LESEKKRLFALTTKGCPAHSQVKFKLGDYLMFGPETRGIPMSILNEMPMEQKIRIPMTANSRSMNLSNSV
1gz0A1          LQEENIWIVGTAGEADHTLYQSKXTGRLALVXGAEGEGXRRLTREHCDEL--ISIPXAGSVSSLNVSVAT
1ipaA1          DWIKQHPLVATTPHAEALYWEANLRPPVAIAVGPEHEGLRAAWLEAAQTQ--VRIPMQGQADSLNVSVSA
1gqiA2          LQALGAE-------GYLLEQTRINKRHVVIVAANSDVGVLYGSFHL-----LRLIQTQHALEKLSLSSA-
1mjgM           LG--------------------------------------------------------------------
1z67A1          SSL-------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AVATYEAWRQLGFVGGV
1v2xA           AVILFEAQRQRLKAG--
1j85A           AVTVYEAWRQLGYKGAV
1gz0A1          GICLFEAVRQ-------
1ipaA1          ALLLYEALRQ-------
1gqiA2          -----------------
1mjgM           -----------------
1z67A1          -----------------