[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF53991.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cv4A1.bssp"
#ERROR : Can't open dsspfile "1lu4A.bssp"
#ERROR : Can't open dsspfile "1st9A.bssp"
#ERROR : Can't open dsspfile "2b5xA1.bssp"
#ERROR : Can't open dsspfile "2cvbA1.bssp"
#ERROR : Can't open dsspfile "1x0rA1.bssp"
#ERROR : Can't open dsspfile "2fy6A1.bssp"
#ERROR : Can't open dsspfile "1wp0A1.bssp"
#ERROR : Can't open dsspfile "1e2yA.bssp"
#ERROR : Can't open dsspfile "1jfuA.bssp"
#ERROR : Can't open dsspfile "1eejA1.bssp"
#ERROR : Can't open dsspfile "1prxA.bssp"
#ERROR : Can't open dsspfile "1ewxA.bssp"
#ERROR : Can't open dsspfile "1v57A1.bssp"
#ERROR : Can't open dsspfile "1kngA.bssp"
#ERROR : Can't open dsspfile "2cx3A1.bssp"
#ERROR : Can't open dsspfile "1xzoA1.bssp"
#ERROR : Can't open dsspfile "1z5yE1.bssp"
#ERROR : Can't open dsspfile "1gp1A.bssp"
#ERROR : Can't open dsspfile "1ovnA2.bssp"
#ERROR : Can't open dsspfile "1a8yA1.bssp"
#ERROR : Can't open dsspfile "1z6nA1.bssp"
#ERROR : Can't open dsspfile "2b5eA3.bssp"
#ERROR : Can't open dsspfile "2dlxA1.bssp"

## Summary of PDB Search
:160
    1e-11  15%  2cv4A1 [c.47.1.10] PEROXIREDOXIN A:24 -- 173
    2e-11  16%  1lu4A  [c.47.1.10] SOLUBLE SECRETED ANTIGEN MPT53
    4e-11  23%  1st9A  [c.47.1.10] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    2e-10  20%  2b5xA1 [c.47.1.10] YKUV PROTEIN A:1 -- 143
    2e-10  22%  2cvbA1 [c.47.1.10] PROBABLE THIOL-DISULFIDE ISOMERASE/THIOREDOXIN
    1e-09  14%  1x0rA1 [c.47.1.10] PROBABLE PEROXIREDOXIN A:2 -- 242
    2e-09  18%  2fy6A1 [c.47.1.10] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    8e-09  14%  1wp0A1 [c.47.1.10] SCO1 PROTEIN HOMOLOG A:138 -- 297
    8e-09  16%  1e2yA  [c.47.1.10] TRYPAREDOXIN PEROXIDASE
    2e-08  16%  1jfuA  [c.47.1.10] THIOL:DISULFIDE INTERCHANGE PROTEIN TLPA
    5e-08  13%  1eejA1 [c.47.1.9] THIOL:DISULFIDE INTERCHANGE PROTEIN A:61 -- 216
    6e-08  13%  1prxA  [c.47.1.10] HORF6
    8e-08  14%  1ewxA  [c.47.1.10] TRYPAREDOXIN I
    1e-07  14%  1v57A1 [c.47.1.9] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBG A:62 --
    4e-07  19%  1kngA  [c.47.1.10] THIOL:DISULFIDE INTERCHANGE PROTEIN CYCY
    6e-06  17%  2cx3A1 [c.47.1.10] BACTERIOFERRITIN COMIGRATORY PROTEIN A:4 -- 163
    1e-05  12%  1xzoA1 [c.47.1.10] HYPOTHETICAL PROTEIN YPMQ A:3 -- 174
    1e-05  21%  1z5yE1 [c.47.1.10] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBE E:49 --
    3e-05  18%  1gp1A  [c.47.1.10] GLUTATHIONE PEROXIDASE
    3e-05  10%  1ovnA2 [c.47.1.7] WINDBEUTEL A:24 -- 145
    4e-05  13%  1a8yA1 [c.47.1.3] CALSEQUESTRIN A:3 -- 126
    4e-05  15%  1z6nA1 [c.47.1.1] HYPOTHETICAL PROTEIN PA1234 A:1 -- 166
    7e-05   6%  2b5eA3 [c.47.1.2] PROTEIN DISULFIDE-ISOMERASE A:240 -- 364
    4e-04  13%  2dlxA1 [c.47.1.24] UBX DOMAIN-CONTAINING PROTEIN 7 A:1 -- 147
:160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSSLDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGL
2cv4A1          -------------------------YVSQGKWFVLFSHPADFTPVXTTEFVSFARRYEDFQRLGVDLIG-
1lu4A           ----DERLQFTA---TTLSGAPFDGASLQGKPAVLWFWTPWCPFC----NAEAPSLSQVAAANPAVTFVG
1st9A           ----SDAPNFVL---EDTNGKRIELSDLKGKGVFLNFWGTWCEPC----KKEFPYMANQYKHFKSQGVEI
2b5xA1          ----QPMPELTGEKAW-LNGEVTREQLIGEKPTLIHFWSISCHLCKEA-MPQVNEFRDKYQDQLNVVAVH
2cvbA1          ----SPLIDAEL---PDPRGGRYRLSQFHEPLLAVVFXCNHCPYVK-GSIGELVALAERYRG-KVAFVGI
1x0rA1          ----ERFPEXEVTTDH-GVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGL
2fy6A1          ------HTLSTLKTA---DNRPASVYLKKDKPTLIKFWASWCPLCLSEL-GQTEKWAQDAKFSSANLITV
1wp0A1          ---------------SLTTHTGKTDKDYLGQWLLIYFGFTHCDVCPEELEKXIQVVDEIDSITTLPDLTP
1e2yA           ----HPAPEFDDALXPNGTFKKVSLSSYKGKYVVLFFYPXDFTFVCPTEIIQFSDDAKRFAEINTEVIS-
1jfuA           ----LKLPDLAF---EDADGKPKKLSDFRGKTLLVNLWATWCVPCRKE-MPALDELQGKLSGPNFEVVAI
1eejA1          -----------------LEKEMIVYKAPQEKHVITVFTDITCGYC--------HKLHEQMADYNALGITV
1prxA           ----DVAPNFEA---NTTVGRIRFHDFLGDSWGILFSHPRDFTPVXTTELGRAAKLAPEFAKRNVKLIA-
1ewxA           --SGLDKYLPGIEKLR-RGDGEVEVKSLAGKLVFFYFSASWCPPCRGFTPQLIEFYDKFHESKNFEVVFC
1v57A1          IEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWRPWVDSGKVQLRTLLVGVIKP
1kngA           -------PLEGLQADN-VQVPGLDPAAFKGKVSLVNVWASWCVPCHD----EAPLLTELGKDKRFQLVGI
2cx3A1          ------APDFTLPNQD-FEPVNLYEVLKRGRPAVLIFFPAAFSPVCTKELCTFRDKXAQLEKANAEVLAI
1xzoA1          ---------------TFQNQDGVSLESLKGEVWLADFIFTNCETICPPMTAHMTDLQKKLKAENIDVRII
1z5yE1          ----------------------------QGKPVLLNVWATWCPTS--------RAEHQYLNQLSIRVVGM
1gp1A           ----------AFSARPLAGGEPFNLSSLRGKVLLIENVASLXGTTVRD-YTQMNDLQRRLGPRGLVVLGF
1ovnA2          ---------------VDLDELSFEKTVERFPYSVVKFDIAYPYGEKHE-AFTAFSKSAHKATKDLLIATV
1a8yA1          ------------------------KNVFKKYEVLALLYHEPPEDDKASQ-RQFEMEELILELAAQVLEDK
1z6nA1          -------------------------QRIERRYRLLVAGEMWCPDC--------QINLAALDFAQRLQPNI
2b5eA3          ------------------------AQYVESGLPLGYLFYNDEEEL--------EEYKPLFTELAKKNRGL
2dlxA1          ----LFRPPIDLMHKGS-FETAKECGQMQNKWLMINIQNVQDFAC--------QCLNRDVWS-------N


                         .         .         *         .         .         .         .:140
query           HSVFEHHDVMTPEALKVFISEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQ
2cv4A1          LSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTARRLGLLHAESATHTVRGVFIVDARGVIRTXLYY-
1lu4A           IATR-----ADVGAMQSFVSKYNLNFTNLNDADGV------IWARYNVPWQPAFVFYRADGTSTFVN---
1st9A           VAVNVGE---SKIAVHNFMKSYGVNFPVVLDTDRQ------VLDAYDVSPLPTTFLINPEGKVVKVVTGT
2b5xA1          MPRSEDDL--DPGKIKETAAEHDITQPIFVDSDHA------LTDAFENEYVPAYYVFDKTGQLRHFQAGG
2cvbA1          NANYEKYPEDAPEKXAAFAEEHGIFFPYLLDETQE------VAKAYRALRTPEVFLFDERRLLRY-----
1x0rA1          SVDSVFS---HIKWKEWIERHIGVRFPIIADPQGTARRLGLLHAESATHTVRGVFIVDARGVIRT-----
2fy6A1          ASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGT------IAQSLNISVYPSWALIGKDGDVQRIVKGS
1wp0A1          LFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVKDEDEDYIVDHTIIXYLIGPDGEFLDYFGQN
1e2yA           CSCDSEYS--HLQWTSVDRKKGGLGPPXLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKLRQI----
1jfuA           NI----DTRDPEKPKTFLKEANLTRLGYFND--QKAKVFQDLKAIGRALGMPTSVLVDPQGCEIATIAGP
1eejA1          RYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKE
1prxA           LSIDSVEDHLAWSKYNSEEPTEKLPFPIIDDRNRELAIPAEKDEKGMPVTARVVFVFGPDKKLKLSILYP
1ewxA           -----TWDEEEDGFAGYFAKMPWLAVP-----FAQSEAVQKLSKHFNVESIPTLIGVDADSGDVVTTRA-
1v57A1          ESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANSDNEKLMDDLGANVTPAIYYMSKENTLQQAV---
1kngA           N-----YKDAADNARRFLGRYGNPFGR------VGVDANGRASIEWGVYGVPETFVVGREGTIVYKLVGP
2cx3A1          -------SVDSPWCLKKFKDENRLAFNLLSDYNREVIKYHEDLKGLKXVAKRAVFIVKPDGTVAYKWVTD
1xzoA1          SFSNDKPKQLKKFAANYFLTGYSQSEIEEFALKSFKAIVKKPEGEDQVIHQSSFYLVGPDGKVLKDYNGV
1z5yE1          N------YKDDRQKAISWLKELGNPYALSL---FDGDGMLGL--DLGVYGAPETFLIDGNGIIRYRHAGD
1gp1A           -------PCNQFGHQENAKNEEILNCLKYVR---------------------------------------
1ovnA2          GVKDYGEL-----ENKALGDRYKVDDK----------------------NFPSIFLFKGNADEYVQLPS-
1a8yA1          GVGFGLVDSEKD---------------------------AAVAKKLGLTEEDSIYVFKEDEVIEYDGEFS
1z6nA1          E-LAIISKGRAEDDLRQRLALERIAIPLVLVLDEEF------NLLGRFVERPQAVLDGGPQALAAYKAGD
2b5eA3          MNFVSIDARKFGRHAG----NLNMKEQFPLFAIHDMTED--LKYGLPQLSEEAFDELSDKIVLESKAIES
2dlxA1          EAVKNIIREHF----------------IFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEWHQ


                         +         .         .         .         .         *         .:210
query           VDDFVxxxxxxxxxxxxxxx
2cv4A1          --------------------
1lu4A           --------------------
1st9A           MT------------------
2b5xA1          SG------------------
2cvbA1          --------------------
1x0rA1          --------------------
2fy6A1          IN------------------
1wp0A1          KR------------------
1e2yA           --------------------
1jfuA           AE------------------
1eejA1          MKEFL---------------
1prxA           ATT-----------------
1ewxA           --------------------
1v57A1          --------------------
1kngA           IT------------------
2cx3A1          --------------------
1xzoA1          EN------------------
1z5yE1          LNP-----------------
1gp1A           --------------------
1ovnA2          --------------------
1a8yA1          ADTLV---------------
1z6nA1          YLE-----------------
2b5eA3          LVK-----------------
2dlxA1          LD------------------