[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF54079.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fzvA1.bssp"
#ERROR : Can't open dsspfile "1nni1.bssp"
#ERROR : Can't open dsspfile "1t0iA.bssp"
#ERROR : Can't open dsspfile "1rttA.bssp"
#ERROR : Can't open dsspfile "1t5bA.bssp"
#ERROR : Can't open dsspfile "1ydgA.bssp"
#ERROR : Can't open dsspfile "1rliA.bssp"
#ERROR : Can't open dsspfile "1zwkA1.bssp"
#ERROR : Can't open dsspfile "1d4aA.bssp"
#ERROR : Can't open dsspfile "1vmeA1.bssp"

## Summary of PDB Search
:188
    7e-23  16%  2fzvA1 [c.23.5.4] PUTATIVE ARSENICAL RESISTANCE PROTEIN A:1 -- 233
    3e-21  23%  1nni1  [c.23.5.4] HYPOTHETICAL PROTEIN YHDA
    1e-20  26%  1t0iA  [c.23.5.4] YLR011WP
    6e-20  23%  1rttA  [c.23.5.4] CONSERVED HYPOTHETICAL PROTEIN
    8e-16  18%  1t5bA  [c.23.5.3] ACYL CARRIER PROTEIN PHOSPHODIESTERASE
    7e-12  12%  1ydgA  [c.23.5.8] TRP REPRESSOR BINDING PROTEIN WRBA
    7e-10  17%  1rliA  [c.23.5.6] TRP REPRESSOR BINDING PROTEIN
    3e-09  15%  1zwkA1 [c.23.5.8] TRP REPRESSOR BINDING PROTEIN WRBA A:4 -- 196
    1e-06  17%  1d4aA  [c.23.5.3] QUINONE REDUCTASE
    2e-04  19%  1vmeA1 [c.23.5.1] FLAVOPROTEIN A:251 -- 398
:188

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSKIAIITGSTRPGRVNIDVANWVLERAQERNDAQYELVDIADFNFPVLDEAMPAGYGQYANEHTKAWAA
2fzvA1          PVRILLLYGSLRARSFSRLAVEEAARLLQFFG-AETRIFDPSDLPLPDQVQSDDH-------PAVKELRA
1nni1           -----VINGTPRKHGRTRIAASYIAALYH------TDLIDLSEFVLPVFNGEAEQSEL----LKVQELKQ
1t0iA           --KVGIIMGSVRAKRVCPEIAAYVKRTIENSEKLKIQVVDLQQIALPLYEDDDIKSVDEYADSKTRSWSR
1rttA           --KVLGISGSLRSGSYNSAALQEAIGLVPP--GMSIELADISGIPLYNEDVYALG-----FPPAVERFRE
1t5bA           MSKVLVLKSSILAGYSQSGLTDYFIEQWREKHADEITVRDLAANPVPVLDGELVGAMRDAPLTPRDELIA
1ydgA           ------------------------------------------------------------------ATPA
1rliA           --KIAVINGGTRSGGNTDVLAEKAVQGFDAEH----------------------------IYLDYDSIIE
1zwkA1          --YILVLYYSRHGA--TAEMARQIARGVEQ------GGFEARVRTVPAVST----------EGALYATLE
1d4aA           --RALIVLAHSERTSFNSDLYAMNFNPIISRKDITGKLKDPANFQYPA--ESVLAYKEGHLSPDIVAEQK
1vmeA1          --------------------------------------------------------------------LK


                         .         .         *         .         .         .         .:140
query           KIAEFDGFIFVTGEYNHSVPAALTNALSYLSAEWNNKAAGIVSYGSAMGVRAAEHLRGILSELQIAHVQK
2fzvA1          LSEWSEGQVWCSPERHGQITSVMKAQIDHLPLEMGRTLAVMQVSGGSQSFNAVNTLRLLGRWMRMFTIPN
1nni1           RVTKADAIVLLSPEYHSGXSGALKNALDFLSSEFKYKPVALVAGGGKGGINALNNXR-------------
1t0iA           IVNALDIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGGHGGSKCNDQLQEVLHGLKMNVIGG
1rttA           QIRAADALLFATPEYNYSMAGVLKNAIDWASRPPEQPAILGASAGRFGTARAQYHLRQTLVFLDVHPLN-
1t5bA           ELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGGKRAVVLSSRGGIHKDTPTDLIAPYL----------
1ydgA           DLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWNKTFSAMTSAQNVNGETTLQTLYMTAMHWGAVLTPP
1rliA           RILQCHILIFATPIYWFGMSGTLKLFIDRWSQTLSVKQAYVIAVGGDNPLPLIQQFEHIFHFMGMSFKGY
1zwkA1          DLKNCAGLALGSPTRFGNMASPLKYFLDGTSSLWGKPAAVFTSTASLHG---------------------
1d4aA           KLEAADLVIFQFPLQWFGVPAILKGWFERVFIGESKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSG
1vmeA1          DIPDSEALIFGVSTYEAEIHPLXRFTLLEIIDKANEKPVLVFVHGWAPS--AERTAGELLKET-------


                         +         .         .         .         .         *         .:210
query           TGLLSIFTDFEYPNFKPSEQGISSVDAMLEQLVVWTKAMSTIRESANx
2fzvA1          QSSIAAFQEFDAAGRMKPSPYYDRIADVMEELVRFTALVRPHREALT-
1nni1           ------------------------------------------------
1t0iA           VAVKIPVGTIPL-PEDIVPQLSVHNEEILQLLASC-------------
1rttA           KPEVMISSAQNAF-----DAQGRLLDDKARELI---------------
1t5bA           ------------------------------------------------
1ydgA           GYTDEVIFKSGGNPYPLLENDRASIRHQVRRQVELTAKL---------
1rliA           V----LGEGNRPGDILRDHQALSAASRLLKRS----------------
1zwkA1          ------------------------------------------------
1d4aA           ILHFCGFQVTYSIGHTPADARIQILEGWKKRL----------------
1vmeA1          ------------------------------------------------