[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF54084.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vp7A.bssp"

## Summary of PDB Search
:81
    5e-10  31%  1vp7A  [a.7.13.1] EXODEOXYRIBONUCLEASE VII SMALL SUBUNIT
:81

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxAQLSYERARDELVEIVKILELGQMGLDESLKYWERGEALAKRCEEHLAGAS
1vp7A           -------------------LPQDFETALAELESLVSAXENGTLPLEQSLSAYRRGVELARVCQDRLAQAE


                         .         .         *         .         .         .         .:140
query           ARVEQALNQAE
1vp7A           QQVKVLEGDLL