[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF54269.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e79G.bssp"
#ERROR : Can't open dsspfile "1fs0G.bssp"
#ERROR : Can't open dsspfile "1w0jG.bssp"
#ERROR : Can't open dsspfile "1bmfG.bssp"
#ERROR : Can't open dsspfile "1ohhG.bssp"
#ERROR : Can't open dsspfile "1t0hB.bssp"
#ERROR : Can't open dsspfile "2pk8A1.bssp"

## Summary of PDB Search
:325
    7e-54  20%  1e79G  [c.49.2.1] ATP SYNTHASE GAMMA CHAIN
    1e-50  32%  1fs0G  [c.49.2.1] ATP SYNTHASE GAMMA SUBUNIT
    1e-43  25%  1w0jG  [c.49.2.1] ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL
    2e-32  19%  1bmfG  [c.49.2.1] BOVINE MITOCHONDRIAL F1-ATPASE
    1e-26  26%  1ohhG  [c.49.2.1] ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL
    3e-13  14%  1t0hB  [c.37.1.1] VOLTAGE-GATED CALCIUM CHANNEL SUBUNIT BETA2A
    2e-09   5%  2pk8A1 [d.274.1.1] UNCHARACTERIZED PROTEIN PF0899 A:2 -- 95
:325

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xATIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASASSLDHPMLRER
1e79G           -ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVG--------------SLALYEKA
1fs0G           ------------------KITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHYK---HPYLEDR
1w0jG           -ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVY-------------------------
1bmfG           ----------------------------------------------------------------------
1ohhG           ----------------------------------------------------------------------
1t0hB           ---KHRFEGRISITRVTADISLAKAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHQLSKT
2pk8A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EGGKRAAVLVVTSDRGMAGGYNHNVXXXXXXXXXXXXXSGYEVVRYVTGKKGVDYYKFRAEDVAGAWTGF
1e79G           DIKTPELIIGVSSDRGLCGAIHSSVAKQMKSEAA----NLKEVKIIGVGDKIRSILHHSDQFLVTFKEVG
1fs0G           DV-KRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVTGM
1w0jG           ---GVGLIIGVSSDRGLCGAIHSSVAK--------------QMKIIGVGDKIRSILTFK---------EV
1bmfG           ----------------------------------------------------------------------
1ohhG           ----------------------------------------------------------------------
1t0hB           SLAPIIVYVKISSPKVLQRLIKSRH---------------------------------------------
2pk8A1          -----------------TRGDLIRILGEIEEKMNELKMDGFNPDIILFGREAYNFLSNLLKKEMEEEGPF


                         +         .         .         .         .         *         .:210
query           SQDPDWAATHNVRRHLIDGFTASSEGEAAWREGLNLSEGQDIQGFDQVHVVYTEFISMLTQNPVVHQLLP
1e79G           RRPPTFGDASVIALELLNSGYE----------------------FDEGSIIFNRFRSVISYKTEEKPIFS
1fs0G           GDNPSLSELIGPVKVMLQAY--------------------DEGRLDKLYIVSNKFINTMSQVPTISQLLP
1w0jG           GRRP-----------------------------PTFGDASVI--ALELSIIFNRFRSVISYKT-------
1bmfG           -----------------------------------------------LKDITRKSIKNIQKITKSMKMVA
1ohhG           ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
2pk8A1          THVSN--------IKIEILEELGGDAVVI----DSKVLGLVPGAAKRIKII-------------------


                         .         .         .         +         .         .         .:280
query           VEPVIEDEIFEKGEDLLSSSGDVEPDYEFEPDADTLLEALLPQYVSRRLFSIFLXXXXXXXXXXXNAMKS
1e79G           LDTISSAE----------------SMSIYDDIDADVLRNYQEYSLANIIYYSLKESTTSEQSARMTAMDN
1fs0G           LPKHK------------------SWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMK-
1w0jG           ------------------------------------LRNYQEYSLANIIYYSLKESTTSEQSARMTAMDN
1bmfG           AAKY-ARAEREL------------KPARVYLCGAIHSSVAKQMKLANIIYYSLKESTTSEQSARMTAMDN
1ohhG           -----------------------LKSIKNIQKITKSMKMVAAAKLCGAIHSSVAKQTTSEQSARMTAMDN
1t0hB           ----------------------------------------------------------------------
2pk8A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ATDNASELVKDLSRVANQARQAQITQEITEIVGGAGALxxxxxxx
1e79G           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
1fs0G           ---------------------------------------------
1w0jG           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
1bmfG           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
1ohhG           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
1t0hB           ---------------------------------------------
2pk8A1          ---------------------------------------------