[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF54313.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ogcA.bssp"
#ERROR : Can't open dsspfile "2ob5A1.bssp"

## Summary of PDB Search
:123
    7e-12  35%  1ogcA  [c.133.1.1] HIGH AFFINITY RIBOSE TRANSPORT PROTEIN RBSD
    1e-09  22%  2ob5A1 [c.133.1.1] HYPOTHETICAL PROTEIN ATU2016 A:1 -- 147
:123

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKSGLLNPDLCYAIARLGHTDTWAVADCGLPIPEHVEIIDLALVFGIPTFEQVLNALKPXXXXXXXXXX
1ogcA           MKKHGILNSHLAKILADLGHTDKIVIADAGLPVPDGVLKIDLSLKPGLPAFQDTAAVLAEEMAVEKVIAA
2ob5A1          -----ALNADVLHALRAXGHGDTLVISDTNFPSDSVARQTTVGKVVSAARAXKAILSVLPLDTPLQPSVG


                         .         .         *         .         .         .         .:140
query           XXTPERIRXXXXXXXXXXXXXXLKAQLAECAFVIRTGETTAYANVIFKSGVAF
1ogcA           AEENAKFNLFSEQEIEYLSHEEFKLLTKDAKAVIRTGEFTPYANCILQAGVLF
2ob5A1          RXEVXGAPDQLEPVQVEVQQEIDAAEIERFAFVITTGETRFYGCFLLTKGV--