[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF54336.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dioA.bssp"
#ERROR : Can't open dsspfile "1sdoA.bssp"
#ERROR : Can't open dsspfile "1zbmA1.bssp"
#ERROR : Can't open dsspfile "1h3dA1.bssp"
#ERROR : Can't open dsspfile "1xs5A.bssp"
#ERROR : Can't open dsspfile "1us4A.bssp"
#ERROR : Can't open dsspfile "2cbiA2.bssp"
#ERROR : Can't open dsspfile "1ii5A.bssp"
#ERROR : Can't open dsspfile "2nxoA1.bssp"

## Summary of PDB Search
:391
    3e-26  11%  1dioA  [c.1.19.3] PROTEIN (DIOL DEHYDRATASE)
    4e-20  11%  1sdoA  [c.52.1.21] BSTYI
    6e-17  11%  1zbmA1 [c.94.1.1] HYPOTHETICAL PROTEIN AF1704 A:2 -- 261
    3e-13  12%  1h3dA1 [c.94.1.1] ATP-PHOSPHORIBOSYLTRANSFERASE A:5 -- 224
    5e-11  20%  1xs5A  [c.94.1.1] MEMBRANE LIPOPROTEIN TPN32
    5e-10  12%  1us4A  [c.94.1.1] PUTATIVE GLUR0 LIGAND BINDING CORE
    6e-10   8%  2cbiA2 [c.1.8.10] HYALURONIDASE A:179 -- 495
    4e-05  20%  1ii5A  [c.94.1.1] HYPOTHETICAL PROTEIN SLR1257
    1e-04  14%  2nxoA1 [c.94.1.1] HYPOTHETICAL PROTEIN SCO4506 A:5 -- 281
:391

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxYVTSTSNNEPADNTPLTIGYVPIACSAPIAIANALGLFKKH
1dioA           -----------------------------VYGTEPVFTDGDDTPWSKGFLASSYASRGLKMRFTSGSGSE
1sdoA           ----------------------------------------------------------------------
1zbmA1          --------------------------------------------IRVAHTPDADDAFXFYAXTH-GKVDT
1h3dA1          ------------------------------------------TRLRIAMQKSRCGIKINLHTQRLIAMAE
1xs5A           -------------------------------------------TVGVGVLSEPHARLLEIAKEE--VKKQ
1us4A           -----------------------------------------------VYFPVA----TGIAKLVN-DANV
2cbiA2          ----------------------------------------------------------------------
1ii5A           ---------------------------------------------------------LDVWRAVA--ESQ
2nxoA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GVNVTLKKYSGWSDLWTAYATEQLDVAHMLSPMTVAINAGVTNASRPMELSFTQNTNGQAITLASKHYGS
1dioA           VQMGYAEGKSCIYITKAAGVQGLQNGSVSCIGVPSAVPSGIRAVLAENICSSLDLECASSNDQTFTHSDM
1sdoA           ----------------------------------------------------------------------
1zbmA1          WLEIEHVIED-IETLNRKAFNAEYEVTAISAHAYAL---------LDDKYRILSAGASVGDGY--GPVVV
1h3dA1          NMPIDIL-RVRDDDIPGLVMDGVVDLGIIGENVLEELNRRAQGEDPRYFTLRRLDFGGCRLSLATPVDEA
1xs5A           HIELRIVEFTNYVALNEAVMRGDILMNFFQHVPHMQQ----FNQEHNGDLVSVGNVHVEPLALYSRTYRH
1us4A           GIRANARSTGGSVANINAINAGEFEXALAQNDIAYAYQGCCIPAFEGKPVKAALYPEVVHVVARKDA--G
2cbiA2          ----------------------------------------------------------------------
1ii5A           KWNSEYVRQNSISAGITAVAEGELDIL--IGPISVT-----PERAAIEGITFTQPSSGIGLLIPGTATPL
2nxoA1          ---------------------------------------------------------------------S


                         +         .         .         .         .         *         .:210
query           VNSAADLKGMVLGIPFEYSVHALLLRDYLASNAVDPIADLKLRLLPPADMVAQLTVEGIAGFIGPEPFNE
1dioA           RRTARLLMQFLPGTDFISSGYSAVPNYDNMFAGSNEDAEDFDDYNVIQRDLKPVREEDVIAIRNKAARAL
1sdoA           -----------------------------------------------------------------EVYSH
1zbmA1          AKSEISLDGKRIAVPGRYTTANLLLKLAVEDF--------EPVEXPFDRIIQAVLDEEVDAGLLIHEGQI
1h3dA1          WDGPLSLNGKRIATSYPH-----LLKRYLDQKGISFK-----SCLLNGSVEVAPRAGLADAICDLVSTGA
1xs5A           V---SDFPGAVIAIPNDSSNEARALR--------------------------------------------
1us4A           IRTVADLKGKRVVVGDVGSGTEQNARQILEAYGLTFDDLGQAIRVSASQGIQLXQDKRADALFYTVGLGA
2cbiA2          ----------------------------------------------------------VEGFYG-TPWTH
1ii5A           FRSVGDLKNKEVAV--------------------------------------------------------
2nxoA1          QVPLDRLDGARVALGSTSRTSVRLAQLLLS--ERFGVQPDYYTCPPDLSLMAAV-------LIGDAALRA


                         .         .         .         +         .         .         .:280
query           RAISNGSGRIWLLTKQVWDKHPCCAVAKAKEWKAEHPTAAQGVLNALEEVSAILSNPAQFDSSARTLSQE
1dioA           QAVFAGMGLPPITDEEVE---AATYAHGSKDMPERNIVEDIKFAQEIINKNR---NG---LEVVKALAQG
1sdoA           LN---GLEYIQVHLPHIWEEIQEIIVSIDAEACRYSPVALNEAFKEKLEAKGWKESRTNYYVTADPKLIR
1zbmA1          TYADYGLKCV-LDLWDWWSEQVKLPLPLNAIRRDLSVEVQEEFLRAXRE--SIAFAIENPDEAIEYA-XK
1h3dA1          TLEANG----LREVEVIYRSKACLIQRD-GEMEESKQQLIDKLLTRIQGV--------------------
1xs5A           ----------------------------------------------------------------------
1us4A           SAILTTPIALVAVDLNRIQA----IAKKYPFYVGF--NIPGGTYKGVDVTTPTVAVQAXLIASERL----
2cbiA2          QDRLDQIKFYGENKLNTYIYAPKDDPYHREKWREPYPESEMQRMQELINASAEN--KVDFVFGISPGIDI
1ii5A           ----------------------------------------------------------------------
2nxoA1          NMIPRYGLDVHDLGALWKEWTVFAVWAARRDYAEREPVITRKVHEAFLA---------------------


                         .         *         .         .         .         .         +:350
query           KYLNQPAALLDGPFSGMYQDWHGQTHTDHERMSFGDPTDPTAIIWMATQIARWGLGGDVLTMDDSTIINA
1dioA           GFTDVAQDMLNAKLTGDYLHTSAIIVGDGQVLSNDVNDYAGPATGYRLQGERWEE---------------
1sdoA           ETLSLEPEEQKKEAAGKEALKSYNQTDFVKDRVAIEAYDLFVKHMAFYVSDKIDVGVEILPMKE----LS
1zbmA1          YSRGLDRERAK-----------------------------------------------------------
1h3dA1          ----------------------------------------------------------------------
1xs5A           ----------------------------------------------------------------------
1us4A           ----------------------------------------------------------------------
2cbiA2          RFDGDAGEEFNHLITKAESLYDMGVRSFAIYWDDILNRFNEEFVKAKGDVKPLITVPTEGAMVSNGQPRA
1ii5A           ----------------------------------------------------------------------
2nxoA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AQSVLTPGLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dioA           -----------------------------------------
1sdoA           KEMSSGISY--------------------------------
1zbmA1          -----------------------------------------
1h3dA1          -----------------------------------------
1xs5A           -----------------------------------------
1us4A           -----------------------------------------
2cbiA2          YTRIFAETV--------------------------------
1ii5A           -----------------------------------------
2nxoA1          -----------------------------------------