[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF54367.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a8iA.bssp"
#ERROR : Can't open dsspfile "2pagA1.bssp"
#ERROR : Can't open dsspfile "1tpzA.bssp"

## Summary of PDB Search
:185
    3e-47  48%  1a8iA  [c.87.1.4] GLYCOGEN PHOSPHORYLASE B
    1e-20  18%  2pagA1 [d.369.1.1] HYPOTHETICAL PROTEIN A:1 -- 135
    5e-04  29%  1tpzA  [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
:185

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYQ
1a8iA           IPAADLSEQISTAGTEASGTGNMXFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDDRLDQRGYN
2pagA1          ----------------------------------------VEIEEQLFINIPFVFKEFLLTVSDVVGSLE
1tpzA           -----------------------------------------------------------EILNLIELRMR


                         .         .         *         .         .         .         .:140
query           PYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHSLIHGYGKDASDTYYVLGDFADYRETRDRMAADY
1a8iA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
2pagA1          PVTVTD--PQSHTYLPEVCATAWDL---GVPRELIPICQDG-----EDYYCVEEDGTVLLWSALVTEESW
1tpzA           KGNIQLTNSAISDALKEIDSSVLNETGSG-----KSSFI-------------------------------


                         +         .         .         .         .         *         .:210
query           ASDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLKPTPxxxx
1a8iA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
2pagA1          -ESVWHWARDVWLE-------------------------------
1tpzA           ---------------------------------------------