[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF54831.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1mwrA3.bssp"
#ERROR : Can't open dsspfile "2bg1A1.bssp"
#ERROR : Can't open dsspfile "2oluA2.bssp"
#ERROR : Can't open dsspfile "2c5wB1.bssp"
#ERROR : Can't open dsspfile "1k25A4.bssp"
#ERROR : Can't open dsspfile "1m6kA.bssp"
#ERROR : Can't open dsspfile "2o3iA1.bssp"
#ERROR : Can't open dsspfile "1es2A.bssp"
#ERROR : Can't open dsspfile "1xa1A.bssp"
#ERROR : Can't open dsspfile "1nrfA.bssp"
#ERROR : Can't open dsspfile "1xp4A2.bssp"
#ERROR : Can't open dsspfile "1mwrA1.bssp"
#ERROR : Can't open dsspfile "1e3uA.bssp"
#ERROR : Can't open dsspfile "1rp5A3.bssp"
#ERROR : Can't open dsspfile "1mwrA2.bssp"
#ERROR : Can't open dsspfile "1wybA1.bssp"
#ERROR : Can't open dsspfile "1bmv21.bssp"
#ERROR : Can't open dsspfile "1e25A.bssp"
#ERROR : Can't open dsspfile "1alqA.bssp"
#ERROR : Can't open dsspfile "2dnsA1.bssp"
#ERROR : Can't open dsspfile "1blsA.bssp"

## Summary of PDB Search
:622
    1e-48  25%  1mwrA3 [e.3.1.1] PENICILLIN-BINDING PROTEIN 2A A:328 -- 668
    3e-34  15%  2bg1A1 [e.3.1.1] PENICILLIN-BINDING PROTEIN 1B A:337 -- 789
    2e-32  16%  2oluA2 [e.3.1.1] PENICILLIN-BINDING PROTEIN 2 A:293 -- 692
    6e-32  19%  2c5wB1 [e.3.1.1] PENICILLIN-BINDING PROTEIN 1A B:266 -- 650
    2e-26  22%  1k25A4 [e.3.1.1] LOW-AFFINITY PENICILLIN-BINDING PROTEIN 2X A:264
    4e-25  18%  1m6kA  [e.3.1.1] BETA-LACTAMASE OXA-1
    2e-24  12%  2o3iA1 [e.73.1.1] HYPOTHETICAL PROTEIN A:2 -- 390
    4e-23  16%  1es2A  [e.3.1.1] DD-TRANSPEPTIDASE
    3e-22  18%  1xa1A  [e.3.1.1] REGULATORY PROTEIN BLAR1
    1e-19  14%  1nrfA  [e.3.1.1] REGULATORY PROTEIN BLAR1
    7e-15  13%  1xp4A2 [e.3.1.1] D-ALANYL-D-ALANINE CARBOXYPEPTIDASE A:25 -- 293
    7e-15  13%  1mwrA1 [d.17.4.5] PENICILLIN-BINDING PROTEIN 2A A:27 -- 138
    8e-15  23%  1e3uA  [e.3.1.1] BETA-LACTAMASE OXA-10
    4e-14  16%  1rp5A3 [d.175.1.1] PENICILLIN-BINDING PROTEIN 2X A:64 -- 263
    6e-14  14%  1mwrA2 [d.175.1.1] PENICILLIN-BINDING PROTEIN 2A A:139 -- 327
    4e-13  11%  1wybA1 [e.3.1.1] 6-AMINOHEXANOATE-DIMER HYDROLASE A:5 -- 392
    8e-11   9%  1bmv21 [b.121.4.2] PROTEIN (ICOSAHEDRAL VIRUS - B AND C DOMAIN)
    2e-10  15%  1e25A  [e.3.1.1] EXTENDED-SPECTRUM BETA-LACTAMASE PER-1
    2e-07  12%  1alqA  [e.3.1.1] CP254 BETA-LACTAMASE
    3e-05  16%  2dnsA1 [e.3.1.1] D-AMINO ACID AMIDASE A:2 -- 363
    2e-04  14%  1blsA  [e.3.1.1] BETA-LACTAMASE
:622

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAEEFLQAWASQDFDTIADITDQADLATEMLSTSF
1mwrA3          ----------------------------------------------------------------------
2bg1A1          ----------------------------------------------------------------------
2oluA2          ----------------------------------------------------------------------
2c5wB1          ----------------------------------------------------------------------
1k25A4          ----------------------------------------------------------------------
1m6kA           ----------------------------------------------------------------------
2o3iA1          ----------------------------------------------------------------------
1es2A           ----------------------------------------------------------------------
1xa1A           ----------------------------------------------------------------------
1nrfA           ----------------------------------------------------------------------
1xp4A2          ----------------------------------------------------------------------
1mwrA1          ------------------------------------INNTIDAIEDKNFKQVYKDSSYEVEXTERPIKIY
1e3uA           ----------------------------------------------------------------------
1rp5A3          ----------------------------------------------------------------------
1mwrA2          ----------------------------------------------------------------------
1wybA1          ----------------------------------------------------------------------
1bmv21          ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
2dnsA1          ----------------------------------------------------------------------
1blsA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DGLQADSVELTLDSVDSRDTIATANFSVVWKLPRDREVSYDSSMTLTKMRNEWTVRWEPSLVHPxxxxNQ
1mwrA3          ----------------------------------------------------------------------
2bg1A1          ----------------------------------------------------------------------
2oluA2          ----------------------------------------------------------------------
2c5wB1          ----------------------------------------------------------------------
1k25A4          ----------------------------------------------------------------------
1m6kA           ----------------------------------------------------------------------
2o3iA1          ----------------------------------------------------------------------
1es2A           ----------------------------------------------------------------------
1xa1A           ----------------------------------------------------------------------
1nrfA           ----------------------------------------------------------------------
1xp4A2          ----------------------------------------------------------------------
1mwrA1          NSLGVKDIN-----IQDRKIKKRVDAQYKIKTN-YGNIDRNVQFNFVKEDGXWKLDWDHSVIIP------
1e3uA           ----------------------------------------------------------------------
1rp5A3          ---------------------------------------------------------------------V
1mwrA2          --------------------------------------------------------------------DQ
1wybA1          ----------------------------------------------------------------------
1bmv21          ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
2dnsA1          ----------------------------------------------------------------------
1blsA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HLELRAIEAQRANVISSDGAPVLAPGSIYRVLADPSAGDADVVVKRVADYLNEAHATDENVNTLDVEDIM
1mwrA3          ----------------------------------------------------------------------
2bg1A1          ----------------------------------------------------------------------
2oluA2          ----------------------------------------------------------------------
2c5wB1          ----------------------------------------------------------------------
1k25A4          ----------------------------------------------------------------------
1m6kA           ----------------------------------------------------------------------
2o3iA1          ----------------------------------------------------------------------
1es2A           ----------------------------------------------------------------------
1xa1A           ----------------------------------------------------------------------
1nrfA           ----------------------------------------------------------------------
1xp4A2          ----------------------------------------------------------------------
1mwrA1          ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
1rp5A3          HQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAVIDTGKILYVEKTQFNKVAEVFHKYLDMEESYVREQL
1mwrA2          SIHIENLKSERGKILDRNNVELANTGTAYEIGIVPKNVS-KKDYKAIAKELSISED--------YIKQQX
1wybA1          ----------------------------------------------------------------------
1bmv21          ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
2dnsA1          ----------------------------------------------------------------------
1blsA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SNLGDSTYSLTTVDANLGARMEQDLAGIPGLTFNEEASMVATDPGFAPDIVSRVARIVEDELEGSNGWRA
1mwrA3          ----------------------------------------------------------------------
2bg1A1          -----------------------------------------------------QERMYDYLAQRDNVSAK
2oluA2          -------------------------------------------------------------------FVK
2c5wB1          ----------------------------------------------------------------------
1k25A4          ----------------------------------------------------------------------
1m6kA           ----------------------------------------------------------------------
2o3iA1          ----------------------------------------------------------------------
1es2A           ----------------------------------------------------------------------
1xa1A           ----------------------------------------------------------------------
1nrfA           ----------------------------------------------------------------------
1xp4A2          ----------------------------------------------------------------------
1mwrA1          ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
1rp5A3          SQPNLKQVSFGAKGNGITYANMMSIKEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENSILAGTDGIIT
1mwrA2          DQNWVQDDTFVPLKTVKXDEYLSDFAKKFHLTTNETESRNYPLEKATSHLLGYVGPIYDKKLQHEDGYRV
1wybA1          ----------------------------------------------------------------------
1bmv21          -----------------------------------------------------LACAMNSSIRGRASSDI
1e25A           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
2dnsA1          ----------------------------------------------------------------------
1blsA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SIVTSNGAVIDDIAYDAPELAPSVRISLDHNVQRAAEEAVDLRAEMKAMMVVMRPSTGEILAVAQTDEAD
1mwrA3          ---------------------------IDAKVQKSIYNNXKNDY---GSGTAIHPQTGELLALVSTNKLT
2bg1A1          ELKNEATQKFYRDLKEIENGGYKITTTIDQKIHSAMQSAVADYGYVEVGNVLMDNQTGAILGFVGGRNYQ
2oluA2          SELXNNKAFKDENLGNVLQSGIKIYTNXDKDVQKTLQNDVDKNKDQQVGATILDSKTGGLVAISGGRDFK
2c5wB1          -LKEVINQVEEETGYNLLTTGMDVYTNVDQEAQKHLWDIYNPDDELQVASTIVDVSNGKVIAQLGARHQS
1k25A4          --------------------------TLSSPLQSFMETQMDAFLEKYMTATLVSAKTGEILATTQRPTFN
1m6kA           ------------------------------DISTVASPLFEGT---EGCFLLYDASTNAEIAQFNKAKCA
2o3iA1          -------------------------------------------------------SPSDLEPLLQGACFF
1es2A           -------------------------------------------------GYAMNNGTGTTLYTKAADT--
1xa1A           --------------------------------------KKPLHNDYQILSKIFGSNSGSFVMSMKKDKYY
1nrfA           ----------------------------------LPGTNVEYED---YSTFFDKFSASGGFVLFNSNRKK
1xp4A2          -------------------------------------------------AIAVEANTGKILYEKDATQ--
1mwrA1          ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
1rp5A3          YEKDRLGNIVPGT---------------------------------------------------------
1mwrA2          TIVDDSNTIAHTLIEKKKKDGKDIQLT-------------------------------------------
1wybA1          -------------------SAAVSRRPGHALARLGAIAAQLPDLEQTYTDAFLVLRGTEVVAEYYRAGFA
1bmv21          YTICSQDCELWNPA---CTKAMTMSFNPNPCSDAWSLEFLKRTGF-HCDIICVTGWTATPMQDV------
1e25A           -------------------------------LKEQIESIVI-GKKATVGVAVWGPDDLEPLLINPFE---
1alqA           ----------------ETAKSVMKEFAAAAKELNDLEKKYNAHI----GVYALDTKSGKEVK--------
2dnsA1          --------------------------DLNNAIQGILDDHVARGVVGVSLALC---LPGEETSLYQSGYAD
1blsA           --------------------------VSEKQLAEVVANTITMKAQSVPGMAVAVIYQGKPHYTFGKADIA


                         .         .         .         .         *         .         .:420
query           KDGDVALMGQYPPGSTFKIITAAAGLAHEGLTPDSIVPCPGTMNIYGRIVTNYNSFSLGNTSLDDAFANS
1mwrA3          EDKKEPLLITTSPGSTQKILTAXIGLNNKTLDDKTSYKIDGKGSWGGYNVTRYEVVN-GNIDLKQAIESS
2bg1A1          ENQNHAFDTKRSPASTTKPLLAGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYS
2oluA2          DVVRNQATDPHPTGSSLKPFLAYGPAENXKWATNHAIQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQS
2c5wB1          SNVSFAVETNRDWGSTMKPITDAPALEYGVYESTATIVHDEPYNYPGTPVYNWDRGYFGNITLQYALQQS
1k25A4          ADRDILYQSNYEPGSAMKVMTLASSIDNNTFPSGEYFNSSE---------------------------LS
1m6kA           T--------QMAPDSTFXIALSLMAFDAEIIDQKTIFKWDKTPKGM----EIWN----SNHTPKTWMQFS
2o3iA1          GSGANFRKGDYYPTDKVRVVDVDEAT-DGDCVXVAYXGAPDA--INQVQWPNGPVE--AALAARQRLESQ
1es2A           ---------RRSTGSTTKIMTAKVVLAQSNLNLDAKVTIQKAYSDYVQAHLIVGDKVTVRQLLYGLMLPA
1xa1A           IYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFD---AWN----KEQDLNTAMQNS
1nrfA           YTIYNESTSRFAPASTYKVFSALLALESGIITKNDSHMTWDGTQYPYKEWN-------QDQDLFSAMSSS
1xp4A2          ---------PVEIASITKLITVYLVYENGSITLSTPVDISDYPYQLTTNSEASNIPXEARNLLEATLVSS
1mwrA1          ----------------------------------------------------------------------
1e3uA           ---------EYLPASTFKIPNAIIGLETGVIKNEQVFKWDGK----PRAMKQWE----RDLTLRGAIQVS
1rp5A3          ----------------------------------------------------------------------
1mwrA2          ----------------------------------------------------------------------
1wybA1          PDD------RHLLMSVSKSLCGTVVGDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQIYNESEVQT
1bmv21          ----------------------------------------------------------------------
1e25A           ---------KFPMQSVFKLHLAMLVLDQGKLDLNQTVIVNRAKVLQNAPIMKAYQGDEFSVPVQQLLQYS
1alqA           FNSDK----RFAYASTSKAINSAILLVPYNLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYS
2dnsA1          KFNKMPMTGDFRIASCTKSFIATGLLVQDGVDLDEPITFPDLPKAAQMPVRILLNHRSGLPDFETSMPMI
1blsA           ANKPVTPQTLFELGSISKTFTGVLGG--------------------------------------------


                         .         .         +         .         .         .         .:490
query           CNTTFADISTNLEPGQLKNVAKQFGLGIDYQIPGLDTMTGSVPAGDIVLDRTESGYGQGLDLASPFGMAL
1mwrA3          DNIFFARVALELGSKKFEKGXKKLGVGEDIPS-DYPFYNAQILDNEI--LLADSGYGQGEILINPVQILS
2bg1A1          WNIPAYWTYRMLRENGVDVKGYMEKMGYEIPE-----------------YGIESLPMGGGIEVTVAQHTN
2oluA2          FNIPALKAWQSVKQNAGNDAPKKFAAKLGLNYEGDIGPSEV--------------LGGSASEFSPTQLAS
2c5wB1          RNVPAVETLNKVGLNRAKTFLNGLGIDYP---------SIHYSNAIS----SNTTESDKKYGASSEKMAA
1k25A4          SNVGMSLLEQKMGDATWLDYLKRFKFGVPTRFGLTDEYAGQLPADNIV-SIAQSSFGQGI-SVTQTQMLR
1m6kA           VVWVSQEITQKIGLNKIKNYLKDFDYG-NQDFSGDERNNG-----------LTEAWLESSLKISPEEQIQ
2o3iA1          GRKLAYVVAPESGA---LGFVVASLVAAKLGLAVVD----ADGAGRAVPSLPXLTYAAAGVPPTPAFLAG
1es2A           GCDAAYALADKYGSGSTRAARVKSFIGKMNTAATNLGLHNTHFDSF-------DGIGNGANYSTPRDLTK
1xa1A           VNWYFERISDQIPKNYTATQLKQLNYG-NKNLGSYK-----------------SYWMEDSLKISNLEQVI
1nrfA           TTWYFQKLDRQIGEDHLRHYLKSIHYGNED------------------FSVPADYWLDGSLQISPLEQVN
1xp4A2          ANSAAIALAEKIAGSEKDFVDXXRAKLLEWGIQDATVVNTTLNNETLGDNIYPGSKKDEENKLSAYDVAI
1mwrA1          ----------------------------------------------------------------------
1e3uA           AVPVFQQIAREVGEVRMQKYLKKFSYG-NQNISG------------------------GIDKF-------
1rp5A3          ----------------------------------------------------------------------
1mwrA2          ----------------------------------------------------------------------
1wybA1          HGRSAGWRTRRHGDPADTYEFLTTLRGDGSTGEFQYCSANTDVLAWIVERVTGLRYVE-ALSTYLWAKLD
1bmv21          ----------------------------------------------------------------------
1e25A           VSHSDNVACDLL----FELVGGPAALHDYIQSMGIKETAVVANEAQMH----ADDQVQYQNWTSMKGAAE
1alqA           DNTANNKIIKEI--GGIKKVKQR------LKELGDKVTNPVRYEIEL----NYYSPKSKKDTSTPAAFGK
2dnsA1          SDKSW---TAQEIVDFSFRHGVQKEPWHGM----EYSNTGYVLAGMIIAHETGKPYSDHLRIFAPLGMK-
1blsA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           VASTAATGSVPTPTLISGHETVASEEVPALDPEVLANVQRMMKSVVNDGTARGMRQTGGQIYAKTGEAEI
1mwrA3          IYSAENNGNINAPHLLKDTKNKVWKK-NIISKENINLLTDGXQQVVNKTHKEDIYRSYANLIGKSGTAEL
2bg1A1          GYQTLANGVYHQKHVISKIEAADGRVVYVYSKATATIMQGLLREVLSSRVTTNPTLANADWIGKTGTTNQ
2oluA2          AFAAIANGGTYNNAHSIQKVVTRDGETIAXSDYTAYXLAEXLKGTFKPGSAYGHGVSGVNXGAKTGTGPD
2c5wB1          AAAFANGGTYYKPMYIHKVVFFSNVGTRAMKETTAYMMTDMMKTVLTYGTGRNAYLAWLPQAGKTGTSNY
1k25A4          AFTAIANGVMLEPKFISAIYDTNNQSVRKSQKEIVGNPSTTRNHMILVGTPLIITVPGQNVAVKSGTAQI
1m6kA           FLRKIINHNLPVK------------------NSAIENTIENMYLQDLDN--------STKLYGKTGAGFT
2o3iA1          ESGLCVELGVRXPQXLRPILTNPQFGQFGGLAXWXXSPAQLGGALPVRGTLSRALKLGRLQDGKVKTAE-
1es2A           IASSAMKNSTFRTVV----------KTKAYTAKTVTKTGSIRTMDTWKNTNGLLSSYSGAIGVKTGSGPE
1xa1A           VFKNMMEN--------------------HFSKKAKNQLSSSLLIKKNEKY---------ELYGKTGTGIV
1nrfA           ILKKFYDNE------------------FDFKQSNIETVKDSIRLEESNG-----RVLSGKTGTSVI---N
1xp4A2          VARNLIKKYPQVLEITK--------------KPSSTFAGXTITSTNYXLEGXPAYR-GGFDGLKTG--TT
1mwrA1          ----------------------------------------------------------------------
1e3uA           --------WLEGQLRISAVNQVYLNKLSA-SKENQLIVKEALVTEAAPEYL---------VHSKTGFSGV
1rp5A3          ----------------------------------------------------------------------
1mwrA2          ----------------------------------------------------------------------
1wybA1          ADRDATITVDTTGFGFAHGGVSCTARDLARVGRMMLDVRRVLAGGSHEMTDKGFTNTFPDGSYTRQWWTG
1bmv21          ----------------------------------------------------------------------
1e25A           ILKKFEQK-------------------TQLSETSQALLWKWMETTTGPERLKGLLPAGTVVAHKTGTSQI
1alqA           TLNKLIAN-------------------GKLSKENKKFLLDLMLNNKSDTLIKDGVPKDYKVADKSG----
2dnsA1          DTWVGTHETFPIEREARGYMHAAADDENP--QWDVSGAGDPVDGVWDSTEWFPLSGANAAGDMVSTPRDI
1blsA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           NEGSHAWFTGYREDDIAFATLVVLGGGSEAAAAVTDQFFVKLDELRxxxxxxxxxxxxxxxx
1mwrA3          -KRQIGWFISYDKDN-----------------------------------------------
2bg1A1          DE--NMWLMLSTPRLTLGGWIGHDQAGYSNNSNYMAHLVNAI--------------------
2oluA2          NAAKDVWINGFPQYTXSVWXGFSKSFVGHSQQEYPQFLY-----------------------
2c5wB1          TDEEDELFAGYTRKYSMAVWTGYSNRGLTVAAKVYRSMMTYLSEGS----------------
1k25A4          DEKNGGYLVGSTNYIFSAV-------------------------------------------
1m6kA           RTLQNGWFEGFIISKYVFVSALTGNLGSNSSIKAKKNAITILNTL-----------------
2o3iA1          ---AXLDFLRRELATLASPGKVVLEDERRCTVLYQNESLLAWDS------------------
1es2A           AKYCLVFAATRGGKTVIGTVLASTSIPASDATKIMNYGF-----------------------
1xa1A           GKYNNGWFVGYVITNYYFATHLSDGKSGKNAELISEKILKEM--------------------
1nrfA           GELHAGWFIGYVETADNTFFFAVHRAAGSSAAEIALSILDKK--------------------
1xp4A2          DKAGESFVGTTVEKGXRVITVVLNAARFTATSSLXDYIS-----------------------
1mwrA1          --------------------------------------------------------------
1e3uA           GTESNAWWVGWVEKEYFFAFNMDIDNESKLPLR-----------------------------
1rp5A3          --------------------------------------------------------------
1mwrA2          --------------------------------------------------------------
1wybA1          NERGNVSGIGIPLTDSVIVKLSWPDPDTEHWHRLQNGIL-----------------------
1bmv21          --------------------------------------------------------------
1e25A           KAGTNDLGIILLPDGRPLLVAVFVKDSAESSRT-----------------------------
1alqA           --------------------------------------------------------------
2dnsA1          VKFLNALFDGRI--------------------------------------------------
1blsA           --------------------------------------------------------------