[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF54857.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2phzA1.bssp"
#ERROR : Can't open dsspfile "1efdN.bssp"
#ERROR : Can't open dsspfile "2chuA1.bssp"
#ERROR : Can't open dsspfile "1n2zA.bssp"
#ERROR : Can't open dsspfile "2etvA1.bssp"

## Summary of PDB Search
:314
    2e-31  21%  2phzA1 [c.92.2.4] IRON-UPTAKE SYSTEM-BINDING PROTEIN A:20 -- 296
    2e-31  20%  1efdN  [c.92.2.1] FERRICHROME-BINDING PERIPLASMIC PROTEIN
    5e-28  21%  2chuA1 [c.92.2.4] ENTEROCHELIN UPTAKE PERIPLASMIC BINDING PROTEIN
    1e-14  23%  1n2zA  [c.92.2.2] VITAMIN B12 TRANSPORT PROTEIN BTUF
    2e-07  19%  2etvA1 [c.92.2.4] IRON(III) ABC TRANSPORTER, PERIPLASMIC IRON- A:25
:314

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEQRIVAXXXXXXXXXX
2phzA1          ------------------------------------------------------DKIAITGSVESXEDAK
1efdN           -------------------------------------------------------NRIVALEWLPVELLL
2chuA1          -------------------------------------------------------SKVVILDLGILDTFD
1n2zA           -------------------------------------------------------PRVITLSPANTELAF
2etvA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXITPVGVAAAKNSDLIPQFLKDRFSADMDLDSIADCGLRQSPDIEAIANLNPTLICANSRADEEVLNK
2phzA1          LLDVHPQGAISFSGK--FPDXFKDI------TDKAEPTGEKXEPNIEKILEXKPDVILASTKFPEKTLQK
1efdN           ALGIVPYGVADTINYRLWVSEPPL-------PDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYSPEMLAR
2chuA1          ALKLNDKVVGVP--AKNLPKYLQQ-------FKNKPSVGGVQQVDFEAINALKPDLIIISGR-QSKFYDK
1n2zA           AAGITPVGVSSYSD---YPP----------QAQKIEQVSTWQGMNLERIVALKPDLVIARGGNAERQVDQ
2etvA1          ------VGVE---DFEXLRPYGRPYILAYPELXSVGPGGPGXLPDLESLITLQPDVVFITYVDRXTAXDI


                         +         .         .         .         .         *         .:210
query           LRTIAPVVTGEGGGENWKQDLLTIAEAAGQKEKAETLLKSYEDSAAEIAANQPANPPTVSFLRTKDQEFQ
2phzA1          ISTAGTTIPVSHISSNWKENXXLLAQLTGKEKKAKKIIADYEQDLKEIKTNDKAKDSKALVIRIRQGNIY
1efdN           IAPGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIRSMKPRFVKARPLLLTTLIDPRHML
2chuA1          LKEIAPTLFNANFLSSFENNVLSVAKLYGLEKEALEKISDIKNEIEKAKS-IVDEDKKALIILTNSNKIS
1n2zA           LASLGIMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPF
2etvA1          QETGIPVVVLSYGDEDLFRSIELAGXILGREERAHEVVDFIRXAQEDLVTREGVESPTVYVGGI--GYXG


                         .         .         .         +         .         .         .:280
query           MYGAQSMAGTVAADCGYARPENQQFTDTAGQDLSAELIAQADADWLFYGMKEGNINPEDTPLWTSLKAVQ
2phzA1          IYPEQVYFNSTLYGDLGLKAPNEVKAAKAQELSSLEKLSEXNPDHIFVQFSDDENADKPDPIWKSLKAVK
1efdN           VFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDHDNSKDMDATPLWQAMPFVR
2chuA1          AFGPQSRFGIIHDVLGINAV----DENIKGKSINSEFILEKNPDYIFLGNKERAQGILDNALVAKTKAAQ
1n2zA           TSGKESIQNQVLEVCGG---EN-IFKDSRVPQVSREQVLARSPQAIVITG-----GPDQIPIKQYWGEQL
2etvA1          AHGIDSTARNVVDELGEGHX-----------FIDPEXLLVWNPEYIFLVLDDYSXHRE---FYESLSAVX


                         .         *         .         .         .         .         +:350
query           SNQAIPVDGDSWYLNASLVSAEIILQGLKDxxxx
2phzA1          EDHVYVNSVDPLAQGGTAWSKVRFLKAAAE----
1efdN           AGRFQRVPAVWFY--GATLSAMHFVRVLDN----
2chuA1          NKKIIYLDPEYWYLASGLESLKTMILEIKN----
1n2zA           KIPVIPLTSD------------------------
2etvA1          RGXVYGILPYNYY---------------------