[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF55227.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1g7dA.bssp"

## Summary of PDB Search
:106
    5e-13  17%  1g7dA  [a.71.1.1] ENDOPLASMIC RETICULUM PROTEIN ERP29
:106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xDAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLAKCYGGDISRK
1g7dA           -PAYDALAGQFIEASSREARQAILKQ-GQDGLSGVKETDKKWASQYLKGKILDQGEDFPAS----ELARI


                         .         .         *         .         .         .         .:140
query           RKLLEKQKAGKKRMKNIGSVEVPQEAFVAxxxxxxx
1g7dA           SKLIENKMSEGKKEELQRSLNI-LTAFRK-------