[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF55235.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ci0K2.bssp"
#ERROR : Can't open dsspfile "2eduA1.bssp"
#ERROR : Can't open dsspfile "2i5hA1.bssp"
#ERROR : Can't open dsspfile "2axtU1.bssp"
#ERROR : Can't open dsspfile "2oceA1.bssp"
#ERROR : Can't open dsspfile "2duyA1.bssp"
#ERROR : Can't open dsspfile "1x2iA1.bssp"
#ERROR : Can't open dsspfile "1bpdA1.bssp"
#ERROR : Can't open dsspfile "1c7yA2.bssp"
#ERROR : Can't open dsspfile "2a1jB1.bssp"
#ERROR : Can't open dsspfile "1u9lA.bssp"
#ERROR : Can't open dsspfile "1kftA.bssp"
#ERROR : Can't open dsspfile "1bvsA2.bssp"
#ERROR : Can't open dsspfile "2csbA3.bssp"
#ERROR : Can't open dsspfile "1bpbA1.bssp"
#ERROR : Can't open dsspfile "1lb2B.bssp"
#ERROR : Can't open dsspfile "1pznA1.bssp"
#ERROR : Can't open dsspfile "2a1jA1.bssp"
#ERROR : Can't open dsspfile "2csbA4.bssp"
#ERROR : Can't open dsspfile "1z00B1.bssp"
#ERROR : Can't open dsspfile "2q0zX1.bssp"
#ERROR : Can't open dsspfile "1pu6A.bssp"
#ERROR : Can't open dsspfile "2p6rA2.bssp"
#ERROR : Can't open dsspfile "1kg2A.bssp"
#ERROR : Can't open dsspfile "1bgxT1.bssp"
#ERROR : Can't open dsspfile "1dgsA1.bssp"
#ERROR : Can't open dsspfile "1e7pC.bssp"

## Summary of PDB Search
:196
    2e-18  17%  3ci0K2 [a.60.16.1] PSEUDOPILIN GSPK K:94 -- 203
    1e-13  33%  2eduA1 [a.60.2.7] KINESIN-LIKE PROTEIN KIF22 A:8 -- 98
    1e-13  19%  2i5hA1 [e.71.1.1] HYPOTHETICAL PROTEIN AF1531 A:16 -- 195
    5e-13  25%  2axtU1 [a.60.12.2] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN U:37 --
    5e-13  36%  2oceA1 [a.60.2.6] HYPOTHETICAL PROTEIN PA5201 A:474 -- 563
    2e-12  42%  2duyA1 [a.60.2.7] COMPETENCE PROTEIN COMEA-RELATED PROTEIN A:11 --
    5e-11  24%  1x2iA1 [a.60.2.5] HEF HELICASE/NUCLEASE A:2 -- 69
    1e-10  31%  1bpdA1 [a.60.6.1] DNA POLYMERASE BETA A:9 -- 91
    1e-10  23%  1c7yA2 [a.60.2.1] HOLLIDAY JUNCTION DNA HELICASE RUVA A:65 -- 150
    2e-10  19%  2a1jB1 [a.60.2.5] DNA EXCISION REPAIR PROTEIN ERCC-1 B:219 -- 296
    2e-09  14%  1u9lA  [a.60.4.2] TRANSCRIPTION ELONGATION PROTEIN NUSA
    3e-09  33%  1kftA  [a.60.2.3] EXCINUCLEASE ABC SUBUNIT C
    3e-08  33%  1bvsA2 [a.60.2.1] PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA)
    4e-08  27%  2csbA3 [a.60.2.4] TOPOISOMERASE V A:410 -- 464
    7e-08  22%  1bpbA1 [a.60.12.1] DNA POLYMERASE BETA A:91 -- 148
    9e-08  15%  1lb2B  [a.60.3.1] DNA-DIRECTED RNA POLYMERASE ALPHA CHAIN
    1e-07  26%  1pznA1 [a.60.4.1] DNA REPAIR AND RECOMBINATION PROTEIN RAD51 A:35
    9e-07  18%  2a1jA1 [a.60.2.5] DNA REPAIR ENDONUCLEASE XPF A:837 -- 898
    2e-06  16%  2csbA4 [a.60.2.4] TOPOISOMERASE V A:465 -- 519
    4e-06  15%  1z00B1 [a.60.2.5] DNA REPAIR ENDONUCLEASE XPF B:823 -- 905
    2e-05  13%  2q0zX1 [a.289.1.1] PROTEIN PRO2281 X:33 -- 208
    6e-05  18%  1pu6A  [a.96.1.5] 3-METHYLADENINE DNA GLYCOSYLASE
    1e-04  24%  2p6rA2 [a.289.1.2] AFUHEL308 HELICASE A:489 -- 686
    2e-04  20%  1kg2A  [a.96.1.2] A/G-SPECIFIC ADENINE GLYCOSYLASE
    2e-04  33%  1bgxT1 [a.60.7.1] TAQ DNA POLYMERASE T:174 -- 289
    2e-04  25%  1dgsA1 [a.60.2.2] DNA LIGASE A:401 -- 581
    2e-04   5%  1e7pC  [f.21.2.1] FUMARATE REDUCTASE CYTOCHROME B SUBUNIT
:196

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ci0K2          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1bpdA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1bpbA1          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
1pu6A           ----------------------------------------------------------------------
2p6rA2          ----------------------------------------------------------------------
1kg2A           ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1e7pC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxLAEGSRVADALAIAGTLPDADLTALNLAQLLVDGTQIHVLAIGEVQPISVDAAATSASGLISLNT
3ci0K2          -----------------------------FNLNALAQPTTASRPLAVQQLIAVPAYRAELIAESLWEFID
2eduA1          ------------------------------------------------DCWELQISPELLAHGRLDLLNE
2i5hA1          -----------LLEVSIRKGKQPLVMDRVYIGVYKIKRRLRYEDLTPAAKTELPYVIEHIIKQDFNDSIT
2axtU1          -----------------------------------------------------VVDEKLGTAYGKIDLNN
2oceA1          ----------------------------------------------------------------GVDVNT
2duyA1          ------------------------------------------------------------QAQTPVSLNE
1x2iA1          -----------------------------------------------------------------LTLAE
1bpdA1          -----------------------------------------------------------------YPHKI
1c7yA2          -------------------------------------------------------------------VER
2a1jB1          ---------------------------------------------------------LLMEKLEQD-FVS
1u9lA           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1bpbA1          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------SETLPESEKYNP
2q0zX1          ----------------------------------------------------------------------
1pu6A           ----------------------------------------------------------------------
2p6rA2          ----------------------------------------------------------------------
1kg2A           -----MLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLWTGLGYYARARNLHKAAQQVATLHGGKFP
1bgxT1          ----------------------------------------------------------------------
1dgsA1          -------------------------------------------------------------------LYH
1e7pC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ATVADLVTLPGVGEKTAQAIIDFRESNGGFSTVEDLLQVKGIGPSKFEQISGLVSP
3ci0K2          EDRSVQTRLGREDSEYLARSVPFYAANQPLADISEMRVVQGMDAGLYQKLKPLVC-
2eduA1          GSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF------
2i5hA1          TRMHQLELLPGVGKKMMWAIIEERK-KRPFESFEDIAQRVKGIQRPEKLI------
2axtU1          TNIAAFIQYRGLYPTLAKLIVK----NAPYESVEDVLNIPGLTERQKQILRENLE-
2oceA1          ASAALLARISGLNSTLAQNIVAHRDANGAFRTRDELKKVSRLGEKTFEQA------
2duyA1          ASLEELXALPGIGPVLARRIVEGR----PYARVEDLLKVKGIGPATLERLRPYLRP
1x2iA1          RQRLIVEGLPHVSATLARRLLKHFGSVERVASVAELMKVEGIGEKIAKEI------
1bpdA1          KSGAEAKKLPGVGTKIAEKIDEFLA-TGKLRKLEKIRQ------------------
1c7yA2          EEVGALVKLPGIGKKTAERLIVEMKDRFKGLHGDLFTPAADLVL------------
2a1jB1          RVTECLTTVKSVNKTDSQTLLTTFGSQLIAASREDLALCPGLGPQKARRL------
1u9lA           AAIDTFTKYLDIDEDFATVLVESTLEELAYVPMKELLEIEGLDEPTVEAL------
1kftA           -----LETIEGVGPKRRQMLLKYMGGLQGNASVEEIAKVPGISQGLAEKI------
1bvsA2          -----LLSVSGVGPRLAMATLAVHDAAALRSDVASLTRVPGIGRRGAERI------
2csbA3          --LAELTKKEGVGRKTAERLLRAFGNPERVFEIEKLASVEGVGERVLRSL------
1bpbA1          ----FLTRVTGIGPSAARKLVDEGIKTLERKNEDKLNHHQRIGLKYFEDF------
1lb2B           ----RPVDDLELTVRSANCLKAHYIGDLVQRTEVELLKTPNLGKKSLTEI------
1pznA1          ----SIEDLPGVGPATAEKLREATLEAIAVASPIELKEVAGISEGTALKI------
2a1jA1          -----LLKMPGVNAKNCRSLMHHVKNIAEALSQDELTSILG-NAANAKQL------
2csbA4          --YASLISIRGIDRERAERLLKKYGGYSKVREAVEELREDGLTDAQIRELKGL---
1z00B1          GPQDFLLKMPGVNAKNCRSLMHHVKNELAALSQDELTSILG-NAANAKQL------
2q0zX1          ----YLKQLPHFTSEHIKRCTDKGVESVFEXEDEERNALLQLTDSQIADV------
1pu6A           VTREWLLDQKGIGKESADAILCYACAKEVMVVDKYSYLF-----------------
2p6rA2          ----ELVRIRHIGRVRARKLYNA-----GIRNAEDIVRASLIGRGIAERV------
1kg2A           ETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRV-----------------
1bgxT1          --------VKGIGEKTARKLLE------EWGSLEALLKLDRLKPAIREKI------
1dgsA1          LRKEDLLGLERMGEKSAQNLLRQIEESKHLERLLYALGLPGVGEVLARNL------
1e7pC           -LYIMMTQPQTIGPVSSSFRM-----------------------------------