[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF55333.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1i8tA1.bssp"
#ERROR : Can't open dsspfile "1ltxR1.bssp"
#ERROR : Can't open dsspfile "1w4xA1.bssp"
#ERROR : Can't open dsspfile "1w4xA2.bssp"
#ERROR : Can't open dsspfile "2hzbA1.bssp"
#ERROR : Can't open dsspfile "1b37A1.bssp"
#ERROR : Can't open dsspfile "1gosA1.bssp"
#ERROR : Can't open dsspfile "2culA1.bssp"
#ERROR : Can't open dsspfile "1cjcA2.bssp"
#ERROR : Can't open dsspfile "1rp0A1.bssp"
#ERROR : Can't open dsspfile "1nvtA1.bssp"
#ERROR : Can't open dsspfile "2vouA1.bssp"
#ERROR : Can't open dsspfile "1fcdA1.bssp"
#ERROR : Can't open dsspfile "1cl0A2.bssp"
#ERROR : Can't open dsspfile "1vqwA1.bssp"
#ERROR : Can't open dsspfile "1vqwA2.bssp"
#ERROR : Can't open dsspfile "1dxlA2.bssp"
#ERROR : Can't open dsspfile "1fl2A2.bssp"
#ERROR : Can't open dsspfile "1mo9A1.bssp"
#ERROR : Can't open dsspfile "1gv4A1.bssp"
#ERROR : Can't open dsspfile "2ivdA1.bssp"
#ERROR : Can't open dsspfile "1h6vA2.bssp"
#ERROR : Can't open dsspfile "1bncA2.bssp"
#ERROR : Can't open dsspfile "1dxyA1.bssp"
#ERROR : Can't open dsspfile "1f8rA1.bssp"
#ERROR : Can't open dsspfile "1cjcA1.bssp"
#ERROR : Can't open dsspfile "1gt8A4.bssp"
#ERROR : Can't open dsspfile "1lnqA3.bssp"
#ERROR : Can't open dsspfile "1b4vA1.bssp"
#ERROR : Can't open dsspfile "1ps9A3.bssp"
#ERROR : Can't open dsspfile "1f8wA1.bssp"
#ERROR : Can't open dsspfile "1hyhA1.bssp"
#ERROR : Can't open dsspfile "1d7yA1.bssp"
#ERROR : Can't open dsspfile "2i0zA1.bssp"
#ERROR : Can't open dsspfile "2gqfA1.bssp"
#ERROR : Can't open dsspfile "1p9oA.bssp"
#ERROR : Can't open dsspfile "1f0yA2.bssp"
#ERROR : Can't open dsspfile "1xhcA1.bssp"
#ERROR : Can't open dsspfile "1yrwA2.bssp"
#ERROR : Can't open dsspfile "1f8wA2.bssp"
#ERROR : Can't open dsspfile "1bhyA1.bssp"
#ERROR : Can't open dsspfile "1fl2A1.bssp"
#ERROR : Can't open dsspfile "1b73A1.bssp"
#ERROR : Can't open dsspfile "1sezA1.bssp"
#ERROR : Can't open dsspfile "1el5A1.bssp"
#ERROR : Can't open dsspfile "1gdhA1.bssp"
#ERROR : Can't open dsspfile "1bwcA2.bssp"
#ERROR : Can't open dsspfile "1b6rA2.bssp"
#ERROR : Can't open dsspfile "1kdgA1.bssp"
#ERROR : Can't open dsspfile "2hy5B1.bssp"
#ERROR : Can't open dsspfile "1d7yA2.bssp"
#ERROR : Can't open dsspfile "1evyA2.bssp"
#ERROR : Can't open dsspfile "1onfA2.bssp"
#ERROR : Can't open dsspfile "1aogA2.bssp"
#ERROR : Can't open dsspfile "2dw4A2.bssp"
#ERROR : Can't open dsspfile "1eyzA2.bssp"
#ERROR : Can't open dsspfile "1an9A1.bssp"
#ERROR : Can't open dsspfile "1lsuA.bssp"
#ERROR : Can't open dsspfile "1djnA3.bssp"
#ERROR : Can't open dsspfile "1w4xA2.bssp"
#ERROR : Can't open dsspfile "1fcdA1.bssp"
#ERROR : Can't open dsspfile "1vqwA2.bssp"
#ERROR : Can't open dsspfile "1dxlA2.bssp"
#ERROR : Can't open dsspfile "1h6vA2.bssp"
#ERROR : Can't open dsspfile "1d7yA1.bssp"
#ERROR : Can't open dsspfile "1bwcA2.bssp"
#ERROR : Can't open dsspfile "1onfA2.bssp"

## Summary of PDB Search
:499
    1e-20  12%  1i8tA1 [c.4.1.3] UDP-GALACTOPYRANOSE MUTASE A:1 -- 244 A:314 -- 367
    3e-19   7%  1ltxR1 [c.3.1.3] RAB ESCORT PROTEIN 1 R:2 -- 444 R:558 -- 614
    2e-18  15%  1w4xA1 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:10 -- 154 A:390 --
    2e-16  31%  1w4xA2 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:155 -- 389
    5e-16  27%  2hzbA1 [c.143.1.1] HYPOTHETICAL UPF0052 PROTEIN BH3568 A:2 -- 312
    2e-14  24%  1b37A1 [c.3.1.2] PROTEIN (POLYAMINE OXIDASE) A:5 -- 293 A:406 --
    4e-14  10%  1gosA1 [c.3.1.2] MONOAMINE OXIDASE A:4 -- 289 A:402 -- 500
    1e-13  13%  2culA1 [c.3.1.7] GLUCOSE-INHIBITED DIVISION PROTEIN A-RELATED A:2
    7e-13  10%  1cjcA2 [c.4.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:6 -- 106 A:332
    1e-12  14%  1rp0A1 [c.3.1.6] THIAZOLE BIOSYNTHETIC ENZYME A:7 -- 284
    5e-12  27%  1nvtA1 [c.2.1.7] SHIKIMATE 5'-DEHYDROGENASE A:111 -- 287
    6e-12  10%  2vouA1 [c.3.1.2] 2,6-DIHYDROXYPYRIDINE HYDROXYLASE A:2 -- 163 A:292
    3e-11  16%  1fcdA1 [c.3.1.5] FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE (FLAVIN-
    4e-11  18%  1cl0A2 [c.3.1.5] THIOREDOXIN REDUCTASE A:119 -- 244
    7e-11  12%  1vqwA1 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:3
    2e-10  22%  1vqwA2 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:181
    2e-10  15%  1dxlA2 [c.3.1.5] DIHYDROLIPOAMIDE DEHYDROGENASE A:153 -- 275
    1e-09  14%  1fl2A2 [c.3.1.5] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F A:326 --
    2e-09   9%  1mo9A1 [c.3.1.5] ORF3 A:2 -- 192 A:314 -- 383
    2e-09  12%  1gv4A1 [c.3.1.5] PROGRAMED CELL DEATH PROTEIN 8 A:121 -- 264 A:398
    9e-09  30%  2ivdA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE A:10 -- 306 A:415 --
    1e-08  12%  1h6vA2 [c.3.1.5] THIOREDOXIN REDUCTASE A:171 -- 292
    2e-08  16%  1bncA2 [c.30.1.1] BIOTIN CARBOXYLASE A:1 -- 114
    2e-07  16%  1dxyA1 [c.2.1.4] D-2-HYDROXYISOCAPROATE DEHYDROGENASE A:101 -- 299
    2e-07  27%  1f8rA1 [c.3.1.2] L-AMINO ACID OXIDASE A:4 -- 319 A:433 -- 486
    2e-07  10%  1cjcA1 [c.3.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:107 -- 331
    2e-07  33%  1gt8A4 [c.4.1.1] DIHYDROPYRIMIDINE DEHYDROGENASE A:184 -- 287
    2e-06   9%  1lnqA3 [c.2.1.9] POTASSIUM CHANNEL RELATED PROTEIN A:116 -- 244
    6e-06  12%  1b4vA1 [c.3.1.2] PROTEIN (CHOLESTEROL OXIDASE) A:9 -- 318 A:451 --
    6e-06  30%  1ps9A3 [c.4.1.1] 2,4-DIENOYL-COA REDUCTASE A:331 -- 465 A:628 --
    7e-06   9%  1f8wA1 [c.3.1.5] NADH PEROXIDASE A:1 -- 119 A:243 -- 321
    8e-06  12%  1hyhA1 [c.2.1.5] L-2-HYDROXYISOCAPROATE DEHYDROGENASE A:21 -- 166
    1e-05  21%  1d7yA1 [c.3.1.5] FERREDOXIN REDUCTASE A:5 -- 115 A:237 -- 308
    1e-05   9%  2i0zA1 [c.3.1.8] NAD(FAD)-UTILIZING DEHYDROGENASES A:1 -- 192 A:362
    1e-05  32%  2gqfA1 [c.3.1.8] HYPOTHETICAL PROTEIN HI0933 A:1 -- 194 A:343 --
    1e-05  15%  1p9oA  [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
    2e-05  12%  1f0yA2 [c.2.1.6] L-3-HYDROXYACYL-COA DEHYDROGENASE A:12 -- 203
    2e-05  17%  1xhcA1 [c.3.1.5] NADH OXIDASE /NITRITE REDUCTASE A:1 -- 103 A:226
    2e-05  14%  1yrwA2 [c.65.1.1] PROTEIN ARNA A:1 -- 203
    6e-05  14%  1f8wA2 [c.3.1.5] NADH PEROXIDASE A:120 -- 242
    7e-05  12%  1bhyA1 [c.3.1.5] P64K A:117 -- 275 A:401 -- 470
    8e-05  17%  1fl2A1 [c.3.1.5] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F A:212 --
    1e-04  18%  1b73A1 [c.78.2.1] GLUTAMATE RACEMASE A:1 -- 105
    1e-04  36%  1sezA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE, MITOCHONDRIAL A:13
    1e-04  18%  1el5A1 [c.3.1.2] SARCOSINE OXIDASE A:1 -- 217 A:322 -- 385
    1e-04  10%  1gdhA1 [c.2.1.4] D-GLYCERATE DEHYDROGENASE A:101 -- 291
    1e-04  15%  1bwcA2 [c.3.1.5] PROTEIN (GLUTATHIONE REDUCTASE) A:166 -- 290
    2e-04  12%  1b6rA2 [c.30.1.1] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    2e-04  12%  1kdgA1 [c.3.1.2] CELLOBIOSE DEHYDROGENASE A:215 -- 512 A:694 -- 755
    2e-04  15%  2hy5B1 [c.114.1.1] INTRACELLULAR SULFUR OXIDATION PROTEIN DSRF
    2e-04  24%  1d7yA2 [c.3.1.5] FERREDOXIN REDUCTASE A:116 -- 236
    3e-04  21%  1evyA2 [c.2.1.6] GLYCEROL-3-PHOSPHATE DEHYDROGENASE A:9 -- 197
    3e-04  20%  1onfA2 [c.3.1.5] GLUTATHIONE REDUCTASE A:154 -- 270
    3e-04  18%  1aogA2 [c.3.1.5] TRYPANOTHIONE REDUCTASE A:170 -- 286
    4e-04  41%  2dw4A2 [c.3.1.2] LYSINE-SPECIFIC HISTONE DEMETHYLASE 1 A:274 --
    7e-04  14%  1eyzA2 [c.30.1.1] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2 A:2
    8e-04  21%  1an9A1 [c.4.1.2] D-AMINO ACID OXIDASE A:1 -- 194 A:288 -- 340
    8e-04  20%  1lsuA  [c.2.1.9] CONSERVED HYPOTHETICAL PROTEIN YUAA
    8e-04  25%  1djnA3 [c.4.1.1] TRIMETHYLAMINE DEHYDROGENASE A:341 -- 489 A:646
    1e-04  17%  1w4xA2 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:155 -- 389(query 9->50)
    9e-04  14%  1fcdA1 [c.3.1.5] FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE (FLAVIN-(query 263->404)
    2e-05   7%  1vqwA2 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:181(query 9->50)
    1e-06  21%  1dxlA2 [c.3.1.5] DIHYDROLIPOAMIDE DEHYDROGENASE A:153 -- 275(query 9->98)
    8e-05  24%  1h6vA2 [c.3.1.5] THIOREDOXIN REDUCTASE A:171 -- 292(query 9->50)
    4e-04  10%  1d7yA1 [c.3.1.5] FERREDOXIN REDUCTASE A:5 -- 115 A:237 -- 308(query 172->234)
    2e-04  24%  1bwcA2 [c.3.1.5] PROTEIN (GLUTATHIONE REDUCTASE) A:166 -- 290(query 9->59)
    3e-04  36%  1onfA2 [c.3.1.5] GLUTATHIONE REDUCTASE A:154 -- 270(query 9->42)
:499

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxEAIYKRTVIVGSGFAGLGMGAQLKRRGDHDFVIIERADDVGGTWRDNTYPGAACDVPSHLYSFSFH
1i8tA1          --------YDYIIVGSGLFGAVCANELKKL-NKKVLVIEKRNHIGGNAYTEDCEGIQIHKYGAHIFHTND
1ltxR1          -----------IVIGTGLPESIIAAACSRSG-QRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQENTENS
1w4xA1          -----------LVVGAGFSGLYA-LYRLRELGRSVHVIETAGDVGGVWYWNRYPGARCDIESIEYCYSFS
1w4xA2          ----------------------------------------------------------------------
2hzbA1          --------KNVVVFGGGTGLSVLLRGLKTFPVSITAIVTVADDGGSSGRLRKELDPPGDVRNVLVALSEV
1b37A1          ---------RVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVVNGGK
1gosA1          -----------VVVGGGISGM-AAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQ
2culA1          -----------LIVGAGFSGAETAFWLAQK-GVRVGLLTQSLDAVMMPFLPPKP-------------PFP
1cjcA2          --------PQICVVGSGPAGFYT-AQHLLKHHSRAHVDIYEKQLVPFGL---------------------
1rp0A1          -----------VVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGWLGGQLFSAMIVRKPAHLGVAYD
1nvtA1          ----------------------------------------------------------------------
2vouA1          --------DRIAVVGGSISGLTAALMLRDAG-VDVDVYERSPQPLSGFGTGIVVQPELVHYLLSMEYVDA
1fcdA1          --------RKVVVVGGGTGGATAAKYIKLADSIEVTLIEPNTDYYTCYLSNEVIGGDRK-----------
1cl0A2          ----------------------------------------------------------------------
1vqwA1          --------RKIAIIGAGPSGLVTAKALLAEKFDQVTLFERRGSPGGVWNYTSTLSNKLPVPSTNPILTTE
1vqwA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1gv4A1          ----APSHVPFLLIGGGTAAFAAARSIRARDGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFR
2ivdA1          -----------AVVGGGISGLAVAHHLRSRG-TDAVLLESSARLGGAVGTHALAGYLVE-----------
1h6vA2          ----------------------------------------------------------------------
1bncA2          --------DKIVIANRGEIALRILRACKELG-IKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNI
1dxyA1          ----------------------------------------------------------------------
1f8rA1          --------KHVVIVGAGMAGLSAAYVLAGAG-HQVTVLEASERPGG--RVRTYRNEEAGWYANLGPMRLP
1cjcA1          ----------------------------------------------------------------------
1gt8A4          ----EAYSAKIALLGAGPASISCASFLARLGYSDITIFEKQEYVGG------------------------
1lnqA3          --------RHVVICGWSESTLECLRELRGSE-VFVLAEDENVRKKVLRSGANFVHGDPTRVSDLEKANVR
1b4vA1          -----------VVIGTGYGAAVSALRLGEAG-VQTLMLEMGQLWNQPGP----DGNIFCGMLNPDKRSSW
1ps9A3          --------KNLAVVGAGPAGLAFAINAAARG-HQVTLFDAHSEIGGQFN---------------------
1f8wA1          ---------KVIVLGSSHGGYEAVEELLNLH-PDAEIQWYEKGDFISFLSXGMQLYLEG---KVKDVNSV
1hyhA1          --------RKIGIIGLGNVGAAVAHGLIAQGVADDYVFIDANEAKADQIDFQDAMANLEAHGNIVINDWA
1d7yA1          -----ALKAPVVVLGAGLASVSFVAELRQAG-YQGLITVVGDEAERPYDRPPL-----------------
2i0zA1          -----------IVIGGGPSGLMAAIGAAEEGANVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHI
2gqfA1          -------YSENIIIGAGAAGLFCAAQLAKLG-KSVTVFDNGKKIGR------------------------
1p9oA           --------RFLDNFSSGRRGATSAEAFLAAG-YGVLFLYRARSAFPYAHR--------------------
1f0yA2          --------KHVTVIGGGLMGAGIAQVAAATG-HTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKA
1xhcA1          ---------KVVIVGNGPGGFELAKQLSQTYEV--TVIDKEPVPYYSKPMLSHYIAGFIPRNRLFPYSLD
1yrwA2          ---------KTVVFAYHDMGCLGIEALLAAGYEISAIFTHTDFYGSVARLAAERGIPVYAPDNVN-----
1f8wA2          ----------------------------------------------------------------------
1bhyA1          -----------VVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGVCLNVGCIPSKALLHNAAVIDEVRH
1fl2A1          -------------IYSARKGIRTGLMGERFGILDTVDIENYISVPKTE----------------------
1b73A1          ---------KIGIFDSGVGGLTVLKAIRNR-YRKVDIVYLGDTARVPYGIRSKD----------------
1sezA1          --------KRVAVIGAGVSGLAAAYKLKIHG-LN------------------------------------
1el5A1          ----------------------------------------------------------------------
1gdhA1          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1b6rA2          --------KQVCVLGNGQLGRMLRQAGEPLG-IAVWPVGLDAEPAAVPFQQSVITAEIER----------
1kdgA1          -----------IIVGAGPGGIIAADRLSEAG-KKVLLLERGGPSTKQTGGTYVAPWATSSGLTKF-----
2hy5B1          --------KKFMYLNRKWEALEVVLIGAAFD-QDVCVLFLDDGVYQLTRG--------------------
1d7yA2          --------SRLLIVGGGVIGLELAATARTAG-VHVSLVETQPRLMSRAAP--------------------
1evyA2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1aogA2          --------RRVLTVGGGFISVEFAGIFNAYKDGQVTLCYRGEMILRGF----------------------
2dw4A2          ---------KVIIIGSGVSGLAAARQLQSFG-MDVTLLEARDRVGGTFRKGNYV----------------
1eyzA2          ----------------------------------------------------------------------
1an9A1          ---------RVVVIGAGVIGLSTALCIHERY-HSVLQPLDVKVYADRFTPFTTTDVA-------------
1lsuA           --------KQFAVIGLGRFGGSIVKELHRMG-HEVLAVDINEEKVNAYAS--------------------
1djnA3          --------DSVLIVGAGPSGSEAARVLMESG-YTVHLTDTAEKIGGHLN---------------------
1w4xA2          --------QRVGVIGTGSSGIQVSPQIAKQA-AELFVFQRTPHFAVPARN--------------------
1fcdA1          ----------------------------------------------------------------------
1vqwA2          --------ESVLVVGGASSANDLVRHLTPVA-KHPIYQSLLGGGDIQNES--------------------
1dxlA2          --------KKLVVIGAGYIGLEMGSVWGRIG-SEVTVVEFASEIVPTMDAEIRKQFQRSL--EKQGMKFK
1h6vA2          --------GKTLVVGASYVALECAGFLAGIG-LDVTVMVRSILLRGFDQD--------------------
1d7yA1          ----------------------------------------------------------------------
1bwcA2          --------GRSVIVGAGYIAVEMAGILSALG-SKTSLMIRHDKVLRSFDSMISTNCTEE-----------
1onfA2          --------KKIGIVGSGYIAVELINVIKRLG-IDSYIFARGN----------------------------


                         .         .         *         .         .         .         .:140
query           PNPNWSQVFSPGPEIQTYLQNFAQDEGLLPHLHFNRNMNNARWDEKEGRWHITTPGQVYIAQFLITGTGH
1i8tA1          KYINDLVEFNRFTNSPLAIYKDKLFNLPFNMNTFHQMWGVKDPQEAQNIINYGDKVPENLEEQAISLVGE
1ltxR1          MWQEQILENEEAIPLSSKDKTIQHVEVFCYASQDKNRITYSQIIKEGRRFNIDLVSKLLYSRDLLIKSNV
1w4xA1          EEVLQEWNWTERYASQPEILRYINFVADKFDLRSGITFHTTVTAAAFDEATNTWTVDTNHGDRIRARYLI
1w4xA2          ----------------------------------------------------------------------
2hzbA1          E-PLLEQLFQ------------------------------------------------------------
1b37A1          MNPIWPIV-----NSTLKLRNFRSDFDYLAQNVYKEDG--------------------------------
1gosA1          NRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPILDHNNFWRTMDDMGREIPSDAPWKA
2culA1          PSLLERAYDPKDERVWAFHARAKYLLEGLRPLHLFQATATGLLLEGNRVVGVRTWGPPARGEKVVLAVGS
1cjcA2          ------------VRFGVAPDHPEVKNVINTFTQTARSDRCAFYGNVEVGRDVTVQELQDAYHAVVLSYGA
1rp0A1          EQDTYVVVKHAALFTSTIMSKLLARFNAVAAEDLIVKGNNWALVAQNHHTQSCMDPNVMEAKIVVSSCGH
1nvtA1          ----------------------------------------------------------------------
2vouA1          LTGERVGSVPADWRFTSYDSIYGGLYELFGPERYHTSKCLVGLSQDSETVQMRFSDGTKAEANWVIGADG
1fcdA1          ------------LESIKHGYDGLRAHGI--QVVHDSAT----GIDPDKKLVKTAGGAEFGYDRCVVAPGI
1cl0A2          ----------------------------------------------------------------------
1vqwA1          PIVGPAALPVYPSPLYRDLQTRIYAQPLLPFIKLATDVLDIEKKDGIFDAVSICNGHYEVPYTGYLYSVP
1vqwA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------ARNDHLTINQWATRIDEILEAPDG
1gv4A1          QW-NGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLD-VRGNMVKLNDGSQITFEKCLIATGG
2ivdA1          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1bncA2          P---------------------------------------------------------------------
1dxyA1          -----------------------------------------------------------IAEFALTDTLY
1f8rA1          EKHRIVREYIRKFDLR--LNEFSQE---------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1lnqA3          GARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPF--------------
1b4vA1          FKNRTEAPLGSFLWLDVVNRNIDPYAGVLDRVNY------------------------------------
1ps9A3          ----------------------------------------------------------------------
1f8wA1          RYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLII-------------------
1hyhA1          ALADADVVISTLGNIKFTSSMVQSVGTNLKESGFHGVLVVISNPVDVITALFQHVTGF------------
1d7yA1          ----------------------------------------------------------------------
2i0zA1          PGNGRFLYSAFSIFNNEDIITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVE
2gqfA1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1f0yA2          GDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIAN
1xhcA1          WYRKRGIEIRLAAKLIDRGRKVVITEKGEVPYDTLVLATGAPNVDLARRSGIHTGRGILIDDNFRT----
1yrwA2          -----------------HPLWVERIAQLSPDVIFSFYYRHLIYDE----ILQLAPAGAFNLHGSLLPKYR
1f8wA2          ----------------------------------------------------------------------
1bhyA1          LAANGIKYPEPELDIDMLRAYKDGVVSRLTGGLAGMAKSRKVDVIQGDGQF-------------------
1fl2A1          -----------GQKLAGALKVHVDEYDV--DVIDSQSASKLIPAAVEGGLHQIETAAVLKARSIIVATGA
1b73A1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1el5A1          --------------------------------KVLTHTRVEDFDISPDSVKIETANGSYTADKLIVSMGA
1gdhA1          -----------------------------------------------------------TAEIAMLLLLG
1bwcA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1kdgA1          DIPGLFESLFTDSNPFWWCKDITVFAGCLVGGGTSVNGALYWYPNDGDFSSSVGWPSSW-----------
2hy5B1          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1dxlA2          LKTKVVGVDTSGDGVKLTVEPSAGGEQT------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LADESYPTIPGLESFTGEKFHSARWDHNVSLKGKRIGVVGTGASAIQIVPEMAKIASELVVFQRTPSYII
1i8tA1          DLYQALIKGYTEKQWGRSAKELPAFII-------------------------------------------
1ltxR1          SRYAEFKNITRILAFREGTVEQVPCSRADVFNSKQLTMVEKRMLMKFLTFCVEYEEHPDEYRAYEGTTFS
1w4xA1          MASGQLSDALTGALFKIDIRGVGNVALKEKWAAGPRTYLGLSTAGFPNLFFIAGPGSPSALSNMLVSIEQ
1w4xA2          -----LPNFPGLKDFAGNLYHTGNWPHEVDFSGQRVGVIGTGSSGIQVSPQIAKQAAELFVFQRTPHFAV
2hzbA1          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1gosA1          PLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQE
2culA1          FLGARLFLGGVVEEAGRLSEASYPDLLE---DLSRLGFRFVEREGEVPPGYRVRYLAFHPEEWEEKTFRL
1cjcA2          EDKSRPPSVPFDPKLGVVVDVPGLYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSA
1rp0A1          -----DGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAP----
1nvtA1          ----------------GIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK-DNNIIIANRTV----
2vouA1          GASVVRKRLLGIETVDRMVHGRVLLIGDAAVTPRP-HAAAGGAKASDDARTLAEVFTKNHDLRGSLQSWE
1fcdA1          ELI--YDKIEQRALTNDAGWCPVDIKTFESSIHKGIHVIGDASIANPMPKSGYSANSQ------------
1cl0A2          --------LPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRA
1vqwA1          FPSLAKLKSPETKLIDDGSHVHNVYQHIFYIPDPTLAFVGLALHVVPFPTSQAQAAFLARVWSGRLKLPS
1vqwA2          ------PNIKGLDEVPGSVLHSSLFREPELFVGESVLVVGGASSANDLVRHLTPVAKHPIYQSLLGG-GD
1dxlA2          -------SLPGVTIDEKKIVSSTGALALSE-IPKKLVVIGAGYIGLEMGSVWGRIGSEVTVVEFAS-EIV
1fl2A2          -----NMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKA
1mo9A1          GEV--IYNVDENDPREYDRFGSAY---LRAMGGRQLIVDRWPFLGGSCPHNACVPHHLFSDCAAELMLAR
1gv4A1          TPRGLEPNVELAKTGGLESDFGGFRVNAELQARSNIWVAGDAACLGRRRVEHHDHA--------------
2ivdA1          ----------------------------------------------------------------------
1h6vA2          --------------GDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSI-LLR
1bncA2          ----------------------------------------------------------------------
1dxyA1          LL---RNMGKVQAQLQAGDYEKAGTFIGKELGQQTVGVMGTGHIGQVAIKLFKGFGAKVIAYDPYPMKGD
1f8rA1          ----------------------------------------------------------------------
1cjcA1          ------GVFSARAFVGWYNGLPENRELAPDLSCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALG
1gt8A4          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
2i0zA1          TIEYENGQTKAVILQTGEVLE-------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1f0yA2          ATTR------------QDRFAGLHNPVPVMKLVEVIKTPMTSQKTFSLVDFSKALGKHPVSCKDTP----
1xhcA1          ----SAKDVY------------AIGD----CAEYSGIIAGTAKAAM----EQARVLAD------------
1yrwA2          GRAPLNWVLVNGETETGVTLHRMKRADAGAIVAQLRIAIAPDDIAITLHHKLCHAARQLLEQTLPAIK--
1f8wA2          --------IPGKDLYLMRGRQWAIKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLG
1bhyA1          ----------------------------------------------------------------------
1fl2A1          KLPNTNWLEGAVERNRMIDAKCETNVKGVFYKQIIIATGEGAKASLSAFDYLIRTKT-------------
1b73A1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1el5A1          WNSKLLSKL-NLDIPDEHFIIDLHPEHNV--------VIAAGFSGFKFSSGVGEVLSQL-ALTGKTEH--
1gdhA1          SA-RRAGEGEKMIRTRSWPGWEPLELVGEKLDNKTLGIYGFGSIGQALAKRAQGFDMDIDYFDTHRA---
1bwcA2          --------IPGASLG-----ITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLR
1b6rA2          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1evyA2          ----------------------------ELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNE----
1onfA2          -----FPPVKGIENISSDEFFNIK-------ESKKIGIVGSGYIAVELINVIKRLGIDSYIFARGN-RIL
1aogA2          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1eyzA2          -----------------------LLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYA----
1an9A1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1d7yA1          -------------------------------LKAPVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAER
1bwcA2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PRMERKYTDGEKRLFQRNPHVIENLRSELFWGGENTFAQRRAIPRFLAEGKKLALDHLAAQVSDEELRAK
1i8tA1          ----------------------------------------------------------------------
1ltxR1          EYLKTQKLTPNLQYFVLHSIAMTSTSCTVDGLKATKKFLQCLGRYGNTPFLFPLYGQGELPQCFCRMCAV
1w4xA1          HVDHIAYMFKNGLTRSEAVLEKEDEWVEHVNEIADETLYPMTASWYTGANVPGKPRV-------------
1w4xA2          PARNAPLDPEFLADLKKRYAEFREESRNTPQEGGPDILAAYRDILRDRDANERVAEFIRNKVRDPEVAER
2hzbA1          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1gosA1          RKFVGGSGQVSERIMDLLGDRV-----KLERPVIYIDQTRENVLVETLNHEMYEAKYV------------
2culA1          KRLEGLYAVGLCV---------------------------------------------------------
1cjcA2          FIKALLDSRGVWPVSFSDW---------------------------------------------------
1rp0A1          ----------------------------------------------------------------------
1nvtA1          ----------------------------------------------------------------------
2vouA1          TRQLQQGHAYLNKVKKMASRLQHG-------------GSFEPGNPAFAFGLPKVD---------------
1fcdA1          ----------------------------------------------------------------------
1cl0A2          EKILIKRLM--DKVENGNIILHTNRTLEEVTGDQMGVGVRLRDTQNSDNIESLDVAGL------------
1vqwA1          KEEQLKWQDELXFSLSGANNXYHSLDYPKDATYI------NKLHDWCKQATPVLEEPSPYWGEKERSIRE
1vqwA2          IQNESLQQVPEITKFDPTTREIY-----------------------------------------------
1dxlA2          PTMDAEIRKQFQRSLEKQGMKFKLKTKVVGVDTSGDGVKLTVEPSAGGEQTIIEADVV------------
1fl2A2          DQVLQDKLRSLKNVDIILNAQTTEVK-----GDGSKVVGLEYRDRVSGDIHNIELAGI------------
1mo9A1          TFSGQ-----YWFPDMTEKVVGIKEVVDLFRAGRNGPHGIMNFQSKEQLNLEY---ILNCPAKVIDNHTV
1gv4A1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1h6vA2          GFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTLKVTAKSTNSEETIEDEFNTV------------
1bncA2          ----------------------------------------------------------------------
1dxyA1          HPDFDKQSDVIDLHVPGIEQNTHIINEAAFNTARPNLIDTQAMLSNLKSGK---LAGVGIDTYEYETEDL
1f8rA1          ----------------------------------------------------------------------
1cjcA1          ALRQSRVPLQVAFTIKELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVRAS
1gt8A4          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1f8wA2          VLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKV-------VTDKNAYDADLV------------
1bhyA1          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1gdhA1          ----------------------------------------------------------------------
1bwcA2          SFDSMISTNCTEELENAGVEVLKFKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCL------------
1b6rA2          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1onfA2          RKFDESVINVLENDMKKN----------------------------------------------------
1aogA2          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------IKLADPSIEVNTDYYTCY
1vqwA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1d7yA1          PYDRPPLSKDFMAHGDAEKIRLDC----------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LTPSYEPGCKRVLISNTYYPALQSPITTLEASALSSINGSTVRAASGEEYELDILIFATGFEATEPPYAQ
1i8tA1          ----------------------------------------------------------------------
1ltxR1          FGGIYCLRHSVQCLVVDKESRKCKAVIDQFG---QRIISKHFIIEDSYLSENTCSRVSRDCYNDLPSN--
1w4xA1          ----------------------------------------------------------------------
1w4xA2          LVPKGYPGTKRLILEIDYYEMFNRDNVHLVDTLSAPIETITPRGVSEREYELDSLVLATGF---------
2hzbA1          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1rp0A1          ----------------------------------------------------------------------
1nvtA1          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1vqwA1          NXWSIRA---------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1mo9A1          EAAGKVFKAKNLILAGTLDVPEQPRSAELAKILGLDLGPKGEVLVNEYLQTSVPNVYAVGDLIGGPMEMF
1gv4A1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1dxyA1          LNLAKHGS--------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1cjcA1          ASRAWGLRFRSPQQVLPSPDGRRAAGIRLAVTRLEGIGEATRAVPTGEDLPCGLVLSSIGY---------
1gt8A4          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1bhyA1          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1gdhA1          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1fcdA1          LSNEVIGGDRKLESIKHGYDGLRAHGIQVDSATGIDPDKKLVKTAGGAEFGYDRCVVAPGIELIYDKIEQ
1vqwA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LIDGCDGLNLSEHWERGMQAYQSVAVAGFPNLLSINGPNTSLGHNSIVYIIESQxxxxxxxxxxxxxxxx
1i8tA1          ----------------------------------------------------------------------
1ltxR1          -VYVCSGPDSGLGNDNAVKQAETLFQQICPNEDFPEDI--------------------------------
1w4xA1          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
2hzbA1          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1rp0A1          ----------------------------------------------------------------------
1nvtA1          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1gv4A1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1dxyA1          ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1bhyA1          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1gdhA1          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1fcdA1          RGKIAQIAGLTNDAGWCPVDIKTFESSIHKGIHVIGDASIANPMPKSGYSANSQ----------------
1vqwA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1i8tA1          ----------------------------------------------------------------------
1ltxR1          ----------------------------------------------------------------------
1w4xA1          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
2hzbA1          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1rp0A1          ----------------------------------------------------------------------
1nvtA1          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1gv4A1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1dxyA1          ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1bhyA1          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1gdhA1          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxx
1i8tA1          ---------
1ltxR1          ---------
1w4xA1          ---------
1w4xA2          ---------
2hzbA1          ---------
1b37A1          ---------
1gosA1          ---------
2culA1          ---------
1cjcA2          ---------
1rp0A1          ---------
1nvtA1          ---------
2vouA1          ---------
1fcdA1          ---------
1cl0A2          ---------
1vqwA1          ---------
1vqwA2          ---------
1dxlA2          ---------
1fl2A2          ---------
1mo9A1          ---------
1gv4A1          ---------
2ivdA1          ---------
1h6vA2          ---------
1bncA2          ---------
1dxyA1          ---------
1f8rA1          ---------
1cjcA1          ---------
1gt8A4          ---------
1lnqA3          ---------
1b4vA1          ---------
1ps9A3          ---------
1f8wA1          ---------
1hyhA1          ---------
1d7yA1          ---------
2i0zA1          ---------
2gqfA1          ---------
1p9oA           ---------
1f0yA2          ---------
1xhcA1          ---------
1yrwA2          ---------
1f8wA2          ---------
1bhyA1          ---------
1fl2A1          ---------
1b73A1          ---------
1sezA1          ---------
1el5A1          ---------
1gdhA1          ---------
1bwcA2          ---------
1b6rA2          ---------
1kdgA1          ---------
2hy5B1          ---------
1d7yA2          ---------
1evyA2          ---------
1onfA2          ---------
1aogA2          ---------
2dw4A2          ---------
1eyzA2          ---------
1an9A1          ---------
1lsuA           ---------
1djnA3          ---------
1w4xA2          ---------
1fcdA1          ---------
1vqwA2          ---------
1dxlA2          ---------
1h6vA2          ---------
1d7yA1          ---------
1bwcA2          ---------
1onfA2          ---------