[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF55378.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f8fA1.bssp"
#ERROR : Can't open dsspfile "1escA.bssp"
#ERROR : Can't open dsspfile "1kolA1.bssp"
#ERROR : Can't open dsspfile "1v3tA2.bssp"
#ERROR : Can't open dsspfile "1a71A1.bssp"
#ERROR : Can't open dsspfile "1uufA1.bssp"
#ERROR : Can't open dsspfile "1kolA2.bssp"
#ERROR : Can't open dsspfile "1a71A2.bssp"
#ERROR : Can't open dsspfile "1bxzA2.bssp"
#ERROR : Can't open dsspfile "1pqwA.bssp"
#ERROR : Can't open dsspfile "1yb5A2.bssp"
#ERROR : Can't open dsspfile "1e3jA2.bssp"
#ERROR : Can't open dsspfile "1e3jA1.bssp"
#ERROR : Can't open dsspfile "1vj0A2.bssp"
#ERROR : Can't open dsspfile "1vj0A1.bssp"
#ERROR : Can't open dsspfile "1h2bA2.bssp"
#ERROR : Can't open dsspfile "1bxzA1.bssp"
#ERROR : Can't open dsspfile "1o89A2.bssp"
#ERROR : Can't open dsspfile "1ztpA1.bssp"
#ERROR : Can't open dsspfile "1lluA2.bssp"
#ERROR : Can't open dsspfile "1qorA1.bssp"
#ERROR : Can't open dsspfile "1gv8A.bssp"
#ERROR : Can't open dsspfile "1v3tA1.bssp"
#ERROR : Can't open dsspfile "1gu7A1.bssp"
#ERROR : Can't open dsspfile "1iyzA1.bssp"
#ERROR : Can't open dsspfile "1txqA1.bssp"
#ERROR : Can't open dsspfile "2ck3H2.bssp"
#ERROR : Can't open dsspfile "1zjcA1.bssp"
#ERROR : Can't open dsspfile "1piwA2.bssp"
#ERROR : Can't open dsspfile "1a9xA3.bssp"
#ERROR : Can't open dsspfile "1o89A1.bssp"
#ERROR : Can't open dsspfile "1e0tA3.bssp"
#ERROR : Can't open dsspfile "1iyzA2.bssp"

## Summary of PDB Search
:366
    4e-27  32%  1f8fA1 [b.35.1.2] BENZYL ALCOHOL DEHYDROGENASE A:4 -- 162 A:337 --
    2e-18   9%  1escA  [c.23.10.1] ESTERASE
    5e-18  13%  1kolA1 [b.35.1.2] FORMALDEHYDE DEHYDROGENASE A:2 -- 160 A:356 --
    5e-18  12%  1v3tA2 [c.2.1.1] LEUKOTRIENE B4 12- A:113 -- 294
    1e-17  27%  1a71A1 [b.35.1.2] LIVER ALCOHOL DEHYDROGENASE A:1 -- 163 A:340 --
    1e-17  25%  1uufA1 [b.35.1.2] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN A:3
    5e-17  19%  1kolA2 [c.2.1.1] FORMALDEHYDE DEHYDROGENASE A:161 -- 355
    7e-17  26%  1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339
    1e-16  21%  1bxzA2 [c.2.1.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:140 -- 313
    2e-16  14%  1pqwA  [c.2.1.1] POLYKETIDE SYNTHASE
    3e-15  15%  1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294
    4e-15  22%  1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312
    6e-15  17%  1e3jA1 [b.35.1.2] NADP(H)-DEPENDENT KETOSE REDUCTASE A:4 -- 142
    7e-15  23%  1vj0A2 [c.2.1.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:156 --
    7e-15  10%  1vj0A1 [b.35.1.2] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:2 -- 155
    2e-14  19%  1h2bA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:155 -- 326
    3e-14  12%  1bxzA1 [b.35.1.2] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:1 -- 139
    1e-11  21%  1o89A2 [c.2.1.1] YHDH A:116 -- 292
    1e-11   8%  1ztpA1 [d.86.1.2] BASOPHILIC LEUKEMIA EXPRESSED PROTEIN BLES03 A:17
    3e-11  25%  1lluA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:144 -- 309
    5e-10  16%  1qorA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:2 -- 112 A:292 -- 327
    6e-10  12%  1gv8A  [c.94.1.2] OVOTRANSFERRIN
    1e-09  11%  1v3tA1 [b.35.1.2] LEUKOTRIENE B4 12- A:1 -- 112 A:295 -- 329
    4e-09  17%  1gu7A1 [b.35.1.2] 2,4-DIENOYL-COA REDUCTASE A:23 -- 160 A:350 --
    1e-08  29%  1iyzA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:1 -- 98 A:270 -- 302
    2e-08  11%  1txqA1 [b.34.10.1] DYNACTIN 1 A:25 -- 98
    2e-08  19%  2ck3H2 [b.93.1.1] ATP SYNTHASE DELTA CHAIN H:17 -- 101
    5e-08   9%  1zjcA1 [e.60.1.1] AMINOPEPTIDASE AMPS A:3 -- 415
    2e-07  17%  1piwA2 [c.2.1.1] HYPOTHETICAL ZINC-TYPE ALCOHOL DEHYDROGENASE-
    5e-07  15%  1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A:1
    2e-06  16%  1o89A1 [b.35.1.2] YHDH A:1 -- 115 A:293 -- 323
    6e-06  12%  1e0tA3 [c.49.1.1] PYRUVATE KINASE A:354 -- 470
    8e-06  16%  1iyzA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:99 -- 269
:366

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXXXXXXXXXXXX
1f8fA1          LKDIAAVTPCKGADFELQALKIRQPQGDEVLVKVVATGMCHTDLIVRDQKYPVPLPAVLGHEGSGIIEAI
1escA           ----------------------------------------------------------------------
1kolA1          -------VEVQKIDYPKMQDPRGKKIEHGVILKVVSTNICGSDQHMVRGRTTAQVGLVLGHEITGEVIEK
1v3tA2          ----------------------------------------------------------------------
1a71A1          IKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESI
1uufA1          ----AVGAYSAKQPLEPMDITRREPGPNDVKIEIAYCGVCHSDLHQVRSEWATVYPCVPGHEIVGRVVAV
1kolA2          ----------------------------------------------------------------------
1a71A2          ----------------------------------------------------------------------
1bxzA2          ----------------------------------------------------------------------
1pqwA           ----------------------------------------------------------------------
1yb5A2          ----------------------------------------------------------------------
1e3jA2          ----------------------------------------------------------------------
1e3jA1          --NLSAVLYK-QNDLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGRIADDPMVIGHEASGTVVKV
1vj0A2          ----------------------------------------------------------------------
1vj0A1          LKAHAMVLEKFNQPLVYKEFEISDIPRGSILVEILSAGVCGSDVHMFRGEDPRVPLPIILGHEGAGRVVE
1h2bA2          ----------------------------------------------------------------------
1bxzA1          ----GFAMLSIGK-VGWIEKEKPAPGPFDAIVRPLAVAPCTSDITVFEGAIGERHNMILGHEAVGEVVEV
1o89A2          ----------------------------------------------------------------------
1ztpA1          ----------------------------------------------------------------------
1lluA2          ----------------------------------------------------------------------
1qorA1          ----RIEFHKHGGPLQAVEFTPADPAENEIQVENKAIGINFIDTYIRSGLYPPSLPSGLGTEAAGIVSKV
1gv8A           ----------------YYAVAVVKKGTDFMIKDLRGKTSCHTGLGRSAGWNIPIG----TLIHRGDIEWE
1v3tA1          TLKKHFQGKPTQSDFELKTVELPPLKNGEVLLEALFLSVDPYMRIASKRLKEGAVM-----MGQQVARVV
1gu7A1          ITAQAVLYTQHGEPTQSFEIDDDNLAPNEVIVKTLGSPVNPSDINQIQGVYPTEPAAPCGNEGLFEVIKV
1iyzA1          ----AWVLKRLGGPLELVDLPEPEAEEGEVVLRVEAVGLNFADHLMRLGAYLTRLH--------------
1txqA1          ----------------------------------------------------------------------
2ck3H2          -----SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVT-----------------------
1zjcA1          ----------------------------------------------------------------------
1piwA2          ----------------------------------------------------------------------
1a9xA3          ----------------------------------------------------------------------
1o89A1          -QTLASVQ----------TLDESRLPEGDVTVDVHWSSLNYKDALAITGKGK------------------
1e0tA3          -----LIVVATQGGKSA--RAVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLVKITSTDDFYRLGKEL
1iyzA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAFSEDGEQVGSHFFGQSTF
1f8fA1          GPNVTELQVGDHVVLSYGYCGKCTQCNTGNPAYCSEFFGRNFSGADSEGNHALC-----VNDHFFAQSSF
1escA           -------TANFGIAPVTNDSERGWCFQAKENYPAVATRSLADKGITLDVQADVSCGGALIH-HFWEKQEL
1kolA1          GRDVENLQIGDLVSVPFNACGRCRSCKEMHTGVCLTVNPARAGGA----------YGYVDMGDWTGGQAE
1v3tA2          ----------------------------------------------------------------------
1a71A1          GEGVTTVRPGDKVPLWTPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPIH-HFLGTSTF
1uufA1          GDQVEKYAPGDLVGVGVDSCKHCEECEDGLENYCDHMTGTYNSPTPDE------------PGHTLG--GY
1kolA2          ----------------------------------------------------------------------
1a71A2          ----------------------------------------------------------------------
1bxzA2          ----------------------------------------------------------------------
1pqwA           ----------------------------------------------------------------------
1yb5A2          ----------------------------------------------------------------------
1e3jA2          ----------------------------------------------------------------------
1e3jA1          GKNVKHLKKGDRVAVEPGPCRRCQFCKEGKYNLCPDL---------------------TFCATPPDDGNL
1vj0A2          ----------------------------------------------------------------------
1vj0A1          VNGEKRDLNGELLKPGDLIVWNRGITCGECYWCKVSKEPYLCPNRKVYGINRGCSEYPHL------RGCY
1h2bA2          ----------------------------------------------------------------------
1bxzA1          GSEVKDFKPGDRVVVPATPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDG-------------------VF
1o89A2          ----------------------------------------------------------------------
1ztpA1          ----------------------------------------------------------DPGSPNSEPVGW
1lluA2          ----------------------------------------------------------------------
1qorA1          GSGVKHIKAGDRVVYAQSAGAYSSVHNIIADKAAILPAAIKVD---------------------------
1gv8A           GIESGSVEQAVAKFFSASEQKLCRQCKGDAKTKCLRN----APYSGYSGAFQCLKDGK-------GDVAF
1v3tA1          ESKNSAFPAGSIVLAQSGWTTHFISDGKGLEKLL------------------------------------
1gu7A1          GSNVSSLEAGDWVIPSHVNFGTWRTHALGNDDDFIKLPN-------------------------------
1iyzA1          ----------------------------------------------------------------------
1txqA1          -------RVGSRVEVIGKHRGTVAYVGATLFATGKWVGVILDEA---KGKNDGTVQGRKYCDEGHGIFVR
2ck3H2          ----------------------------------------------------------------------
1zjcA1          ----------------------------------------------------------------------
1piwA2          ----------------------------------------------------------------------
1a9xA3          ----------------------------------------------------------------------
1o89A1          ------IIRNFPMIPGIDFAGTV--RTSEDPRF--HAGQEVLLTGW--------------GVGENHWGGL
1e0tA3          ALQSGLAHKGDVVVMVS-----GALVPSGTTNTASV----------------------------------
1iyzA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXX
1f8fA1          ATYALSRENNTVKVTKD-FPFDQLVKFYAFDEINQAAIDSRKGITLKPIIKIA-----------------
1escA           PFGAGELPPQQDALKQDT--QLTVGSLGGNTLGFNRILKQCSDELRKPSLLPG-DPVDGDEPAAKCGEFF
1kolA1          YVLVPYADFNLLKLPDRDKAMEKINIAEVVGVQVIS-LDDAPRGYGEFDA--------------------
1v3tA2          ------------------------------LTAYFGLLEVCGVKGGETVLVSAAAGAVGSVVGQIAKLKG
1a71A1          SQYTVVDEISVAKIDAAF----------ALDPLITHVLPFEKINEGFDLLRSG-----------------
1uufA1          SQQIVVHERYVLRIRVAD----------------------------------------------------
1kolA2          ------------------------------PTGYHGAVTA-GVGPGSTVYVAGAGPVGLAAAASARLLGA
1a71A2          ------------------------------STGYGSAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGA
1bxzA2          ------------------------------TTGFHGAELA-DIELGATVAVLGIGPVGLMAVAGAKLRGA
1pqwA           ------------------------------LTAWHSLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIG
1yb5A2          ------------------------------FTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYG
1e3jA2          ------------------------------SVGVHA-CRRAGVQLGTTVLVIGAGPIGLVSVLAAKAYGA
1e3jA1          ARYYVHAADFCHKLPDNCNVKQLVTHSFKLEQTVDA-FEAARKKADNTIKVMI-----------------
1vj0A2          ------------------------------ATAYHAFDEYPESFAGKTVVIQGAGPLGLFGVVIARSLGA
1vj0A1          SSHIVLDPETDVLKVSEKITHRLPL------KEANKALELMESREALKVIL-------------------
1h2bA2          -------------ISREKLVEMAPLADAGITAYRAVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTP
1bxzA1          GEFFHVADMNLAHLPKEVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLI---------------------
1o89A2          ----------------------------------------------------------------------
1ztpA1          IAVYGQGYSPNSGDVQGLQAAWEALQTSGRPITPGTLRQTHHVLSGKWLXHLAPGFKLDHAWAGIARAVV
1lluA2          ---------------------------------VYKGLKQTNARPGQWVAISGIGGLGHVAVQYARAMGL
1qorA1          ----------------------------------------------------------------------
1gv8A           VKHTTVQENAPEEKDEYEL--------------LCLDGTRQPVDSYKTCNWAR-----------------
1v3tA1          ----------------------------------------------------------------------
1gu7A1          ----------------------------------------------------------------------
1iyzA1          ----------------------------------------------------------------------
1txqA1          QSQIQV----------------------------------------------------------------
2ck3H2          ----------------------------------------------------------------------
1zjcA1          -----------------------------------LVKVGMNVQPKQPVFIRVETLELTHLIVEEAYHCG
1piwA2          ----------------------------------------------------------------------
1a9xA3          -----------------------------------------KRTDIKSILILGAGPIVIGQACEFDYSGA
1o89A1          AEQARVKGDWLVAMPQGQAAKEISLSEAPNFAEAII----NNQIQGRTLVK-------------------
1e0tA3          ----------------------------------------------------------------------
1iyzA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXVDIHNSRLEMAKELGATHTINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTV
1f8fA1          ----------------------------------------------------------------------
1escA           GTGDGKQWLDDQFERVGAELEELLDRIGYFAPDAKR-----VLVGYPRLVPEDTTKCLTAAGQTQLPFAD
1kolA1          ----------------------------------------------------------------------
1v3tA2          CKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKI
1a71A1          ----------------------------------------------------------------------
1uufA1          ----------------------------------------------------------------------
1kolA2          AVVIVGDLNPARLAHAKAQGFEIADLSLDTPLHEQIAALLGEPGHEGAKHEAPATVLNSLMQVTRVAGKI
1a71A2          ARIIGVDINKDKFAKAKEVGATECVNPQYKKPIQEVLTEMSNGVDFSFEVIGRLDTMVTALCCQEAYGVS
1bxzA2          GRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTGKGVDAAIIAGGNADIMATAVKIVKPGGTI
1pqwA           ARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFADEILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRF
1yb5A2          LKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRV
1e3jA2          FVVC-TARSPRRLEVAKNCGADVTLVVDPAKEEERIRSAIGDLPNVTIDCSGNEKCITIGINITRTGGTL
1e3jA1          ----------------------------------------------------------------------
1vj0A2          ENVIVIAGSPNRLKLAEEIGADLTLNRRETSVEERRKATHGRGADFILEATGDSRALLEGSELLRRGGFY
1vj0A1          ----------------------------------------------------------------------
1h2bA2          ATVIALDVKEEKLKLAERLGADHVVDARRDPVKQVMELTRGRGVNVAMDFVGSQATVDYTPYLLGRMGRL
1bxzA1          ----------------------------------------------------------------------
1o89A2          -----VSGRESTHEYLKSLGASRVLPRDEFAE---SRPLEKQVWAGAIDTVGDKVL-AKVLAQMNYGGCV
1ztpA1          EGRLQVAKVSRAKEGGRQVICVYTDDFTDRLGVLEADSAIAAGIKCLLTYKP-DVYTYLGIYRANRWHLC
1lluA2          HVAA-IDIDDAKLELARKLGASLTVNARQEDPVEAIQRDIGGAH-GVLVTAVSNSAFGQAIGMARRGGTI
1qorA1          ----------------------------------------------------------------------
1gv8A           ----------------------------------------------------------------------
1v3tA1          ----------------------------------------------------------------------
1gu7A1          ----------------------------------------------------------------------
1iyzA1          ----------------------------------------------------------------------
1txqA1          ----------------------------------------------------------------------
2ck3H2          ----------------------------------------------------------------------
1zjcA1          ASDVRVVYSDPTLKRLKFENESVEHFANHEIKSEARMDYVKRGAANLALISEDPDL-MDGIDSQKLQAFQ
1piwA2          -----ISRSSRKREDAMKMGADHYIATLEEGDWGEKYFDTFD---LIVVC--ASSLTNIMPKAMKVGGRI
1a9xA3          QACKALREEGYRVINVNSNPATIMTDPEMADATYVRKIIEKERPDAVLPTMG-GQTALNCALELERQGVL
1o89A1          ----------------------------------------------------------------------
1e0tA3          ----------------------------------------------------------------------
1iyzA2          -----AASRPEKLALPLALGAEEAATYAEVPERA----KAWGGLDLVLEVRG--KEVEESLGLLAHGGRL


                         .         *         .         .         .         .         +:350
query           GLVGAPAPGAEATFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLxxxxxxxxxxxxx
1f8fA1          ----------------------------------------------------------------------
1escA           IPQDALPVLDQIQ---------------------------------------------------------
1kolA1          ----------------------------------------------------------------------
1v3tA2          AICGAISVYNRMGPSPESIIYKQLRIEGFIVYRWQGDVRLRDLMKWVLEG--------------------
1a71A1          ----------------------------------------------------------------------
1uufA1          ----------------------------------------------------------------------
1kolA2          GIPGLYVTEDAAAKIGSLSIRFGLKSHSFHTGQTPVMKYNRALMQAIMWDR-------------------
1a71A2          VIVGVP-PDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKK-------------------
1bxzA2          ANVNYFGEGEVLPVLEWGCGMAHKTIKGGLCP--GGRLRMERLIDLVFYKR-------------------
1pqwA           IELGKKDVYADASLGLSASFSVVDLDLNLKLQPARYRQLLQHILQHVADGKLEVLPV-------------
1yb5A2          IVVGSRGT---IEINPRDTMAKESSIIGVTLFSSTKEEF-QQYAAALQAG--------------------
1e3jA2          MLVG--MGSQMVTVPLVNACAREIDIK----SVFRYCNDYPIALEMVASGR-------------------
1e3jA1          ----------------------------------------------------------------------
1vj0A2          SVAGVAVPQDPVPFKVYEWLVKNATFKGIWVSD--TSHF-VKTVSITSRNYQLLSKL-------------
1vj0A1          ----------------------------------------------------------------------
1h2bA2          IIVGY---GGELRFPTIRVISSEVSFEGSLVGN--YVEL-HELVTLALQGK-------------------
1bxzA1          ----------------------------------------------------------------------
1o89A2          AACGL-AGGFTLPTTVMPFILRNVRLQGVDSVMERRAQAWQRLVADLPESFY------------------
1ztpA1          PTLYESRF--------------------------------------------------------------
1lluA2          ALVG--LPPGDFPTPIFDVVLKGLHIAGSIVG--TRADL-QEALDFAGEG--------------------
1qorA1          ----------------------------------------------------------------------
1gv8A           ----------------------------------------------------------------------
1v3tA1          ----------------------------------------------------------------------
1gu7A1          ----------------------------------------------------------------------
1iyzA1          ----------------------------------------------------------------------
1txqA1          ----------------------------------------------------------------------
2ck3H2          ----------------------------------------------------------------------
1zjcA1          QQNARA----------------------------------------------------------------
1piwA2          VSISIPEQH-------------------------------------------------------------
1a9xA3          EEFGVTMIGATA----------------------------------------------------------
1o89A1          ----------------------------------------------------------------------
1e0tA3          ----------------------------------------------------------------------
1iyzA2          VYIGAAE----APIPPLRLMRRNLAVLGFWLTP--LLRE-GALVEEALGFLLPR----------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxx
1f8fA1          ----------------
1escA           ----------------
1kolA1          ----------------
1v3tA2          ----------------
1a71A1          ----------------
1uufA1          ----------------
1kolA2          ----------------
1a71A2          ----------------
1bxzA2          ----------------
1pqwA           ----------------
1yb5A2          ----------------
1e3jA2          ----------------
1e3jA1          ----------------
1vj0A2          ----------------
1vj0A1          ----------------
1h2bA2          ----------------
1bxzA1          ----------------
1o89A2          ----------------
1ztpA1          ----------------
1lluA2          ----------------
1qorA1          ----------------
1gv8A           ----------------
1v3tA1          ----------------
1gu7A1          ----------------
1iyzA1          ----------------
1txqA1          ----------------
2ck3H2          ----------------
1zjcA1          ----------------
1piwA2          ----------------
1a9xA3          ----------------
1o89A1          ----------------
1e0tA3          ----------------
1iyzA2          ----------------