[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF55431.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1lzwA.bssp"

## Summary of PDB Search
:100
    8e-19  27%  1lzwA  [d.45.1.2] PROTEIN YLJA
:100

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxPWLCIVWDDPVNLMSYVTYVFQTVLGFSKKRATELMMQVHTEGKA
1lzwA           -------------------------MYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVAYQGKA


                         .         .         *         .         .         .         .:140
query           VVSSGEKDKVEGDVKKLHTAGLWATMQQAx
1lzwA           ICGVFTAEVAETKVAMVNKYALLCTLEKA-