[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF55454.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1o89A2.bssp"
#ERROR : Can't open dsspfile "1ztpA1.bssp"
#ERROR : Can't open dsspfile "1v3tA2.bssp"
#ERROR : Can't open dsspfile "1o89A1.bssp"
#ERROR : Can't open dsspfile "1yb5A2.bssp"
#ERROR : Can't open dsspfile "1h2bA2.bssp"
#ERROR : Can't open dsspfile "2oplA1.bssp"
#ERROR : Can't open dsspfile "1a71A2.bssp"
#ERROR : Can't open dsspfile "1lluA2.bssp"
#ERROR : Can't open dsspfile "1vj1A1.bssp"
#ERROR : Can't open dsspfile "1iyzA2.bssp"
#ERROR : Can't open dsspfile "1e3jA2.bssp"
#ERROR : Can't open dsspfile "1a9xA3.bssp"
#ERROR : Can't open dsspfile "1iyzA1.bssp"
#ERROR : Can't open dsspfile "1wkvA1.bssp"
#ERROR : Can't open dsspfile "1pqwA.bssp"
#ERROR : Can't open dsspfile "1gu7A1.bssp"
#ERROR : Can't open dsspfile "1piwA2.bssp"
#ERROR : Can't open dsspfile "1uufA1.bssp"
#ERROR : Can't open dsspfile "1v3tA1.bssp"
#ERROR : Can't open dsspfile "1vj0A2.bssp"
#ERROR : Can't open dsspfile "1o8cA2.bssp"
#ERROR : Can't open dsspfile "1kolA1.bssp"
#ERROR : Can't open dsspfile "1bxzA2.bssp"
#ERROR : Can't open dsspfile "1gv8A.bssp"
#ERROR : Can't open dsspfile "1bxzA1.bssp"
#ERROR : Can't open dsspfile "1f8fA1.bssp"
#ERROR : Can't open dsspfile "1qycA.bssp"
#ERROR : Can't open dsspfile "1a71A1.bssp"
#ERROR : Can't open dsspfile "1ujmA.bssp"
#ERROR : Can't open dsspfile "1vj0A1.bssp"
#ERROR : Can't open dsspfile "1kolA2.bssp"
#ERROR : Can't open dsspfile "1snyA.bssp"
#ERROR : Can't open dsspfile "2fr0A1.bssp"
#ERROR : Can't open dsspfile "1vm6A3.bssp"
#ERROR : Can't open dsspfile "2bgkA1.bssp"
#ERROR : Can't open dsspfile "2hjsA1.bssp"
#ERROR : Can't open dsspfile "1i24A.bssp"
#ERROR : Can't open dsspfile "2bkaA1.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "1qorA1.bssp"
#ERROR : Can't open dsspfile "1xq6A.bssp"
#ERROR : Can't open dsspfile "2ib0A1.bssp"

## Summary of PDB Search
:335
    2e-27  53%  1o89A2 [c.2.1.1] YHDH A:116 -- 292
    1e-15   7%  1ztpA1 [d.86.1.2] BASOPHILIC LEUKEMIA EXPRESSED PROTEIN BLES03 A:17
    4e-15  18%  1v3tA2 [c.2.1.1] LEUKOTRIENE B4 12- A:113 -- 294
    3e-14  48%  1o89A1 [b.35.1.2] YHDH A:1 -- 115 A:293 -- 323
    8e-14  16%  1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294
    1e-12  20%  1h2bA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:155 -- 326
    1e-11  12%  2oplA1 [d.227.1.1] HYPOTHETICAL PROTEIN A:4 -- 185
    2e-11  11%  1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339
    4e-11  23%  1lluA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:144 -- 309
    4e-11  17%  1vj1A1 [b.35.1.2] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE A:-1 --
    1e-10  21%  1iyzA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:99 -- 269
    2e-10  16%  1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312
    7e-09  16%  1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A:1
    8e-09  36%  1iyzA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:1 -- 98 A:270 -- 302
    1e-08  11%  1wkvA1 [c.79.1.1] CYSTEINE SYNTHASE A:2 -- 383
    2e-08  17%  1pqwA  [c.2.1.1] POLYKETIDE SYNTHASE
    6e-08  16%  1gu7A1 [b.35.1.2] 2,4-DIENOYL-COA REDUCTASE A:23 -- 160 A:350 --
    7e-08  21%  1piwA2 [c.2.1.1] HYPOTHETICAL ZINC-TYPE ALCOHOL DEHYDROGENASE-
    1e-07  24%  1uufA1 [b.35.1.2] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN A:3
    2e-07  24%  1v3tA1 [b.35.1.2] LEUKOTRIENE B4 12- A:1 -- 112 A:295 -- 329
    2e-07  17%  1vj0A2 [c.2.1.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:156 --
    2e-07  66%  1o8cA2 [c.2.1.1] YHDH A:116 -- 192
    3e-07  19%  1kolA1 [b.35.1.2] FORMALDEHYDE DEHYDROGENASE A:2 -- 160 A:356 --
    5e-07  19%  1bxzA2 [c.2.1.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:140 -- 313
    3e-06   6%  1gv8A  [c.94.1.2] OVOTRANSFERRIN
    2e-05  24%  1bxzA1 [b.35.1.2] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:1 -- 139
    9e-05  18%  1f8fA1 [b.35.1.2] BENZYL ALCOHOL DEHYDROGENASE A:4 -- 162 A:337
    9e-05  26%  1qycA  [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1
    1e-04  16%  1a71A1 [b.35.1.2] LIVER ALCOHOL DEHYDROGENASE A:1 -- 163 A:340 --
    3e-04  35%  1ujmA  [c.2.1.2] ALDEHYDE REDUCTASE II
    3e-04  25%  1vj0A1 [b.35.1.2] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:2 --
    4e-04  17%  1kolA2 [c.2.1.1] FORMALDEHYDE DEHYDROGENASE A:161 -- 355
    4e-04  33%  1snyA  [c.2.1.2] SNIFFER CG10964-PA
    4e-04  41%  2fr0A1 [c.2.1.2] ERYTHROMYCIN SYNTHASE, ERYAI A:1657 -- 1915
    4e-04  14%  1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 --
    5e-04  26%  2bgkA1 [c.2.1.2] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE A:11 --
    5e-04  22%  2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
    7e-04  18%  1i24A  [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
    8e-04  18%  2bkaA1 [c.2.1.2] TAT-INTERACTING PROTEIN TIP30 A:5 -- 236
    8e-04  36%  1bxkA  [c.2.1.2] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    8e-04  19%  1qorA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:2 -- 112 A:292 -- 327
    8e-04  33%  1xq6A  [c.2.1.2] UNKNOWN PROTEIN
    8e-04   6%  2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:17
:335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxDPSFLGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIP
1o89A2          ----------------------------------------------------------------------
1ztpA1          ------------------------------------------------------------------RTTP
1v3tA2          ----------------------------------------------------------------------
1o89A1          ---------------------------------LPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIP
1yb5A2          ----------------------------------------------------------------------
1h2bA2          ----------------------------------------------------------------------
2oplA1          -----------------------------------------------VNGVNVDQLXATIEQIKAKPEIA
1a71A2          ----------------------------------------------------------------------
1lluA2          ----------------------------------------------------------------------
1vj1A1          -----------------------------LLDALNEGQVQVRTLYLSVDPYXRCKXNEDTGTDYLAPWQL
1iyzA2          ----------------------------------------------------------------------
1e3jA2          ----------------------------------------------------------------------
1a9xA3          ----------------------------------------------------------------------
1iyzA1          ----------------------------------EEGEVVLRVEAVGLNFADHLMRLGAYLTRLHPPFIP
1wkvA1          ------------------------------------GFSYLENAREVLRSGEARCNPRSEPEYSRIPVGD
1pqwA           ----------------------------------------------------------------------
1gu7A1          ---------------------------------LAPNEVIVKTLGSPVNPSDINQIQGVYPSTTEPAAPC
1piwA2          ----------------------------------------------------------------------
1uufA1          ---------------------------------PGPNDVKIEIAYCGVCHSDLHQVRSEWAGTVY-PCVP
1v3tA1          ---------------------------------LKNGEVLLEALFLSVDPYMRIASKRL----KEGAVMM
1vj0A2          ----------------------------------------------------------------------
1o8cA2          ----------------------------------------------------------------------
1kolA1          ---------------------------------KIEHGVILKVVSTNICGSDQHMVRGRTTA--QVGLVL
1bxzA2          ----------------------------------------------------------------------
1gv8A           ---------------------------------KGTDFMIKDLRGKTSCHTGLGRSAGWN------IPIG
1bxzA1          ----------------------------------GPFDAIVRPLAVAPCTSDIHTVFEGAIGERH-NMIL
1f8fA1          ---------------------------------PQGDEVLVKVVATGMCHTDLIVRDQKYPV--PLPAVL
1qycA           ----------------------------------------------------------------------
1a71A1          ---------------------------------PKAHEVRIKMVATGICRSDDHVVSGTLV--TPLPVIA
1ujmA           ----------------------------------------------------------------------
1vj0A1          ---------------------------------IPRGSILVEILSAGVCGSDVHMFRGEDPRVPL-PIIL
1kolA2          ----------------------------------------------------------------------
1snyA           ----------------------------------------------------------------------
2fr0A1          ----------------------------------------------------------------------
1vm6A3          ----------------------------------------------------------------------
2bgkA1          ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1i24A           ----------------------------------------------------------------------
2bkaA1          ----------------------------------------------------------------------
1bxkA           ----------------------------------------------------------------------
1qorA1          ---------------------------------PAENEIQVENKAIGINFIDTYIRSG----LYPPPSLP
1xq6A           ----------------------------------------------------------------------
2ib0A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GIDVVGTVIESADPRFGRGDEVVLNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQVXXXXXXXXXX
1o89A2          ----------------------------------------------------------------------
1ztpA1          ATELDAWL-----AKYPPSQVTRYGDPGSPNSEPVGWIAVYGQGYSPNSGDVQGLQAAWEALQTSGRPIT
1v3tA2          ----------------------------------------------------------------------
1o89A1          GIDFAGTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGQAAKEI----------
1yb5A2          ----------------------------------------------------------------------
1h2bA2          ----------------------------------------------------------------------
2oplA1          QFKFRATNQ-----WXGGTHNQATIKDFYGAXAEDDTRKPXVFDLDEPPVLLGEANPVEYLLVALSGCLT
1a71A2          ----------------------------------------------------------------------
1lluA2          ----------------------------------------------------------------------
1vj1A1          AQVAIGIVEESKHQKLAKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGLKV-----------------
1iyzA2          ----------------------------------------------------------------------
1e3jA2          ----------------------------------------------------------------------
1a9xA3          ----------------------------------------------------------------------
1iyzA1          GMEVVGVV---------EGRRY---AALVP---QGGLAERVAVPKGALLPLP------------------
1wkvA1          GCSHTLEELGVFDIPGEMVFPSPLDFFERG---KPTPLVRSRLQLPNGVRVWLKLEWYNPFSLSVKDRP-
1pqwA           ----------------------------------------------------------------------
1gu7A1          GNEGLFEVIKVGSSSLEAGDWVIPSHV-----NFGTWRTHALGNDDDFIKLPNPAQ--SKANGKPNGLTD
1piwA2          ----------------------------------------------------------------------
1uufA1          GHEIVGRVVAVGDQVEKYGDLVGVGTPDEPGHTLGGYSQQIVVHERYVLRIRVA----------------
1v3tA1          GQQVAR-VVESKNSAFPAGSIVL------AQSGWTTHFISDGKGLEKLLTEWPDKKIQY-----------
1vj0A2          ----------------------------------------------------------------------
1o8cA2          ----------------------------------------------------------------------
1kolA1          GHEITGEVIERDVENLQIGDLVSVPGYVDMGDWTGGEYVLVPYADFNLLKLPDRDKAMEK---INIAEVV
1bxzA2          ----------------------------------------------------------------------
1gv8A           TLIHRGDIEWIESGSVEQAVAKF------FSASCVPGATTEQKLCRQCKGDAKTKCLRNAPYSGYSGAFQ
1bxzA1          GHEAVGEVVESEVKDFKPGDRVMLAGWKFSNVKDGVFGEFFHVNDADLAHLPKEVDPSKL----------
1f8fA1          GHEGSGIIEA------------------------------------------------------------
1qycA           ----------------------------------------------------------------------
1a71A1          GHEAAGIVESIGEGVTTVEGNFCLKNDLSMRGTMQDGTSRFTCRGKPIHHFLGTSTFSQ-----------
1ujmA           ----------------------------------------------------------------------
1vj0A1          GHEGAGRV--------------------------------------------------------------
1kolA2          ----------------------------------------------------------------------
1snyA           ----------------------------------------------------------------------
2fr0A1          ----------------------------------------------------------------------
1vm6A3          ----------------------------------------------------------------------
2bgkA1          ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1i24A           ----------------------------------------------------------------------
2bkaA1          ----------------------------------------------------------------------
1bxkA           ----------------------------------------------------------------------
1qorA1          GTEAAGIVSKSGVKHIKAGDRVV-----YAQSALGAYSSVHNIIADKAAILPAAIKVDVA----------
1xq6A           ----------------------------------------------------------------------
2ib0A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXSVNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDIIDRAE
1o89A2          ---VMALEDAGVRPQDGEIVVTGASGGVGSTAVALLHKLGYQVVAVSGR-ESTHEYLKSLGASRVLPRDE
1ztpA1          PGTLRQLAITHHVLSGKWLXHLAPGFKLDHAWAGIARAVVEGRLQVAKVSPRAKEGGRQVICVYTDDFTD
1v3tA2          ---YFGLLEVCGVKGGETVLVSAAAGAVGSVVGQIAKLKGCKVVGAA-GSDEKIAYLKQIGFDAAFNYKT
1o89A1          ----------------------------------------------------------------------
1yb5A2          -----ALIHSACVKAGESVLVHGASGGVGLAACQIA-RAYGLKILGTAGTEEGQKIVLQNGAHEVFNHRE
1h2bA2          -----AVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTPATVIALDVKEEKLKLAERLGADHVVDARR
2oplA1          TSLVAHAAARGIALRGVKSRYEGDIDLRGFLGLSEEVPVGYREIRVF-----------------------
1a71A2          -----SAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKD-KFAKAKEVGATECVNPQD
1lluA2          -----GLKQTNARPGQW-VAISG-IGGLGHVAVQYARAMGLHVAAIDIDDA-KLELARKLGASLTVNARQ
1vj1A1          ----KETVAKGLENXGVAFQSXXTGGNVGKQIVCISEDSS------------------------------
1iyzA2          ---YLALKRAQARPGE-KVLVQAAAGALGTAAVQVARAMGLRVLAAASRPEKLALPL-ALGAEEAATYAE
1e3jA2          -----ACRRAGVQL--GTTVLVIGAGPIGLVSVLAAKAYGAF-VVCTARSPRRLEVAKNCGADVTLVVDP
1a9xA3          ------------KRTDIKILILGA-GPIVIGQACEFDYSGAQACKALREEGYRVINVNSNPATIMTDPEM
1iyzA1          ----------------------------------------------------------------------
1wkvA1          --AVEIISRLSRRVEKGSLVADATSSNFGVALSAVARLYGYRARVYLPG---------------------
1pqwA           -----SLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKR-EMLSRLGVEYVGDSRS
1gu7A1          AKSIETLYD-GTKPLHELYQDGVANSKDGKQLI-------------------------------------
1piwA2          ----SPLVRNGCGP--GKKVGIVGLGGIGSMGTLISKAMGAETYVIS-RSSRKREDAMKMGADHYIATLE
1uufA1          ----------------------------------------------------------------------
1v3tA1          ----------------------------------------------------------------------
1vj0A2          ---YHAFDEYP-ESFAGKTVVIQGAGPLGLFGVVIARSLGAENVIVIAGSPNRLKLAEEIGADLTLNVEE
1o8cA2          ---VMALEDAGVRPQDGEIVVTGASGGVGSTAVALLHKLGYQVVAVSG-RESTHEYLKSLGA--------
1kolA1          GVQVISLDDAPRGY-----GEFD-AGVPKKFVIDPHKTFS------------------------------
1bxzA2          ----------DIELGA-TVAVLGI-GPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKD
1gv8A           CL---KDGKGDVAFVKHTTVQENAPEEKDEYELLCLDGTRYKTCNWAR----------------------
1bxzA1          ----------------------------------------------------------------------
1f8fA1          ----------------------------------------------------------------------
1qycA           ------------------ILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNS--------------
1a71A1          ----------------------------------------------------------------------
1ujmA           -----AKIDNAVLPEGSLVLVTGANGFVASHVVEQLLEHGY-KVRGTARSASKL----------------
1vj0A1          ----------------------------------------------------------------------
1kolA2          ----HGAVTAGVGP--GSTVYVAGAGPVGLAAAASARLLGAAVVIVGDLNPARLAHAKAQGFEIADLSLD
1snyA           ------------------ILITGCNRGLGGLVKALLNQPPQ-HLFTTCRNREQAK---------------
2fr0A1          ----------------GTVLVTGGTGGVGGIARWLA-RRGA-PHLLLVSRSGPDA---------------
1vm6A3          ------------------YGIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGVE-----------------
2bgkA1          -------------------IITGGAGGIGETTAKLFVRYGA-KVVIADIADDHGQ---------------
2hjsA1          ------------------VAVVGATGSVGEALVGLLDERDF-PLHRLHLLASAES---------------
1i24A           ------------------VMVIGGDGYCGW-ATALHLSKKNYEVCIVDNLVRRLFDH-------------
2bkaA1          ------------------VFILGASGETGRVLLKEILEQGLFSKVT------------------------
1bxkA           ------------------ILITGGAGFIGSLVRYIINETSDAVVVVAGNLMSLAPVAQSERFADICDRAE
1qorA1          ----------------------------------------------------------------------
1xq6A           ------------------VLVTGASGRTGQIVYKKLKEGSDKFVAKGLVRSAQG----------------
2ib0A1          ------------------YGYGIVSALSPPGVNFLVADALK-QHRHRRDDVIVMLSA----------RGV


                         .         .         .         +         .         .         .:280
query           LSEKGRPLQKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGPDLPGTVLPFILRGVHLVGINSVD
1o89A2          -FAESRPLEKQVWAGAIDTVGDKVLAKVLAQMNYGGCVAACGLAGGFTLPTTVMPFILRNVRLQGVDSVM
1ztpA1          RLGVLEADSAIRAAGILTYKPDVYTYLGIYRANRWHLCPTLYES--------------------------
1v3tA2          LEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNPGPSPESIIYKQLRIEGFIVYR
1o89A1          ----------------------------------------------------------------------
1yb5A2          VNKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEIN--PRDTMAKESSIIGVTLFS
1h2bA2          VKQVMELTRGRGVNVAMDFVGSATVDYTPYLLGRMGRLIIVGYGGELRFP--TIRVISSEVSFEG--SLV
2oplA1          ----------------------------------------------------------------------
1a71A2          YKKPIQEVLTEMSNGGVDGRLDTMVTALSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGG
1lluA2          EDPVEAIQRDIGGAHGVTAVSNSAFGQAIGMARRGGTIALVGLPPG-DFPTPIFDVVLKGLHIAG--SIV
1vj1A1          ----------------------------------------------------------------------
1iyzA2          VPER---AKAWGGLDLVLEVRGKEVEESLGLLAHGGRLVYIGA---AEAPIPPLRLMRRNLAVLG--FWL
1e3jA2          AKERIRSAIGDLPNVTIDCSGNEKCITGINITRTGGTLM-LVGMGSQMVTVPLVNACAREIDIKS---VF
1a9xA3          ADATYIEIEKERPDAVLPTMGGQTALNCALELERQGVLEEFGVTMIGATADAI-----------------
1iyzA1          ----------------------------------------------------------------------
1wkvA1          ----------------------------------------------------------------------
1pqwA           VDEILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYADASLGLAALAKSASFSVVDNLK
1gu7A1          ----------------------------------------------------------------------
1piwA2          EGDWGEKY-FDTFDLIVVCASSLTDIDMPKAMKVGGRIVSISIPEQHEML-SLKPYGLKAVSISY-SALG
1uufA1          ----------------------------------------------------------------------
1v3tA1          ----------------------------------------------------------------------
1vj0A2          RRKAIMDITHGRGADFLEATGSRALLEGSELLRRGGFYS-VAGVAVPQDPVPFKVYVLKNATFKG--IWV
1o8cA2          ----------------------------------------------------------------------
1kolA1          ----------------------------------------------------------------------
1bxzA2          IESQIMNLTEGKGAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGPVPRLEWGCGMAHKTIKG-----
1gv8A           ----------------------------------------------------------------------
1bxzA1          ----------------------------------------------------------------------
1f8fA1          ----------------------------------------------------------------------
1qycA           ----------------------------------------------------------------------
1a71A1          ----------------------------------------------------------------------
1ujmA           ----------------------------------------------------------------------
1vj0A1          ----------------------------------------------------------------------
1kolA2          LHEQIAALLGEPEVDCAHEAPATVLNSLMQVTRVAGKIGIPGLYVTEDPGAVDAAAKIGSLSI-------
1snyA           ----------------------------------------------------------------------
2fr0A1          ----------------------------------------------------------------------
1vm6A3          ----------------------------------------------------------------------
2bgkA1          ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1i24A           ----------------------------------------------------------------------
2bkaA1          ----------------------------------------------------------------------
1bxkA           LAR-------------------------------------------------------------------
1qorA1          ----------------------------------------------------------------------
1xq6A           ----------------------------------------------------------------------
2ib0A1          TAPIAAA-GYQLPMQVSSAADAARLAVRMENDGATAWRAVVEHA--------------------------


                         .         *         .         .         .         .         +:350
query           APRELRRRAWALLSEHLDTAVLDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1o89A2          TPPERRAQAWQRLVADLPESFY---------------------------------
1ztpA1          -------------------------------------------------------
1v3tA2          WQGDVREKALRDLMKWVL-------------------------------------
1o89A1          -------------------------------------------------------
1yb5A2          STKEEFQQYAAALQAGME-------------------------------------
1h2bA2          GNYVELHELVTLALQG---------------------------------------
2oplA1          -------------------------------------------------------
1a71A2          FK---SKDSVPKLVADFM-------------------------------------
1lluA2          GTRADLQEALDFAGE----------------------------------------
1vj1A1          -------------------------------------------------------
1iyzA2          TPLLREGALVEEALGFLL-------------------------------------
1e3jA2          RYCNDYPIALEMVASG---------------------------------------
1a9xA3          -------------------------------------------------------
1iyzA1          -------------------------------------------------------
1wkvA1          -------------------------------------------------------
1pqwA           LQPARYRQLLQHILQHVADGKLE--------------------------------
1gu7A1          -------------------------------------------------------
1piwA2          SIKELN-------------------------------------------------
1uufA1          -------------------------------------------------------
1v3tA1          -------------------------------------------------------
1vj0A2          SDTSHFVKTVSITSRNY--------------------------------------
1o8cA2          -------------------------------------------------------
1kolA1          -------------------------------------------------------
1bxzA2          -------------------------------------------------------
1gv8A           -------------------------------------------------------
1bxzA1          -------------------------------------------------------
1f8fA1          -------------------------------------------------------
1qycA           -------------------------------------------------------
1a71A1          -------------------------------------------------------
1ujmA           -------------------------------------------------------
1vj0A1          -------------------------------------------------------
1kolA2          -------------------------------------------------------
1snyA           -------------------------------------------------------
2fr0A1          -------------------------------------------------------
1vm6A3          -------------------------------------------------------
2bgkA1          -------------------------------------------------------
2hjsA1          -------------------------------------------------------
1i24A           -------------------------------------------------------
2bkaA1          -------------------------------------------------------
1bxkA           -------------------------------------------------------
1qorA1          -------------------------------------------------------
1xq6A           -------------------------------------------------------
2ib0A1          -------------------------------------------------------