[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF55467.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xp3A1.bssp"
#ERROR : Can't open dsspfile "2g0wA1.bssp"
#ERROR : Can't open dsspfile "1qtwA.bssp"
#ERROR : Can't open dsspfile "1i60A.bssp"
#ERROR : Can't open dsspfile "1k77A.bssp"
#ERROR : Can't open dsspfile "1a0cA.bssp"
#ERROR : Can't open dsspfile "2hbvA1.bssp"

## Summary of PDB Search
:282
    9e-11  13%  1xp3A1 [c.1.15.1] ENDONUCLEASE IV A:2 -- 298
    4e-10  14%  2g0wA1 [c.1.15.4] LMO2234 PROTEIN A:10 -- 284
    1e-07   9%  1qtwA  [c.1.15.1] ENDONUCLEASE IV
    6e-06  22%  1i60A  [c.1.15.4] IOLI PROTEIN
    6e-05  19%  1k77A  [c.1.15.5] HYPOTHETICAL PROTEIN YGBM
    7e-05  11%  1a0cA  [c.1.15.3] XYLOSE ISOMERASE
    8e-04   9%  2hbvA1 [c.1.9.15] 2-AMINO-3-CARBOXYMUCONATE 6-SEMIALDEHYDE A:3 --
:282

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxIGVQMMMLKDQVAELGMYPVLEKLKELNIASVEVSQIPMNEENTAALERGISELGIEVGALSVAFGP
1xp3A1          ---IGSHVSMSGKKMLL----AASEEAVSYGATTFMIYTKPIEELNIEAGRKHMEQNGIEEIIIHAPYII
2g0wA1          -------------------------------------------------------EHNXKVTEVEYIWGT
1qtwA           ---------------------------------------APLTTQTIDEFKAACEKYHYTSAQILPNLGH
1i60A           ---------------------------------------------------------HIKPLALN-ALVF
1k77A           ---------------------PFIERFRKAGFDAVEF-LFP-YNYSTLQIQKQLEQNHLTLALFNTAWGL
1a0cA           ----------------------------------------KNLDTIVAMIKDYLKTSKTKVLWGT-ANLF
2hbvA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SAAPGVDSLENDFDKIVADCKRLGVKYTRIGMMPFQAMTSKEATETWAAQVEPYAARLAVEGITLCYHNH
1xp3A1          NVGNTTKPETFQLRMEIERTSALGVAKQIVLHPGA---HVGAGADAGIQQIIKGLNEVLDQTVNIALETM
2g0wA1          AEDRTAEQQKK-EQTTFHXARLFGVKHINCGL------LEKIPEEQIIVALGELCDRAEELIIGLEFXPY
1qtwA           PVTEALEKSRDAFIDEMQRCEQLGLSLLNFPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAG
1i60A           FNNRGHNEIITEFKGXXETCKTLGVKY--VVAVPLVTEQKIVKEEIKKSSVDDIAEKIALEFVG--HPQC
1k77A           SALPGRHEAHADIDLALEYALALNCEQVHVAGVVPAGEDAERYRAVFIDNIRYAADRFAPHGKRILVESP
1a0cA           SNPRFVHGASTSCNKALEITKELGGENYREGYETLLNTDMEFELDNFARFLHMAVDYAKEIGFEGQFLIE
2hbvA1          -----VYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKV


                         +         .         .         .         .         *         .:210
query           HVDLHKFGNERIFDIVRRVAPSLFFEVDLHWVQRGGMAPLDMLKEYAGVCKLIHVKDFRVTELPEEAMEL
1xp3A1          AGKGTECGREEIAKIIDGVKEKLSVCFDTCHTHDAGYDIVNNFDGVLNEFDKIVGIDRLQVLHINDSKNV
2g0wA1          S-GVADL--QAAWRVAEACRDNAQLICDTWHWARANQTAESIKNVPADRIVSIQLCDVHETPYKELREES
1qtwA           QGSNLGFKFEHLAAIIDGVESRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAK
1i60A           TVNTF----EQAYEIVNTVRDNVGLVLDSFHFHAXGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDE-
1k77A           GVKPHYLFSYQALAIVEEVRDNVFIQLDTFHAQKVDGNLTHLIRDYAGKYAHVQIAGL-----PDRH---
1a0cA           PKPKEPTKHANVLAFLRKYDLDKYFKVNIEANHLAFHDFQHELRYARINGVLGSIDANTGDMLLGW-DTD
2hbvA1          LAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGD-----------------------------------


                         .         .         .         +         .         .         .:280
query           FTAGDFMKGYEKFVNIVEFAEVGQGNMNWPELLPASKAAGAEYFFIEQDMTYGRDPFDCIKDSREYLxxx
1xp3A1          RGAGKD-----------RHENIGFGHIGYKALHHIVHHPQLTVPKILETPYVGEDKKDKKPPYKLEI---
2g0wA1          LHDRLAP---------------GEGYGDTVGFAKILKEHG------------------------------
1qtwA           STFGS---------RVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQ---
1i60A           -----------------DRVWPGQGAIDLDAHLSALKEIG------------------------------
1k77A           --------------------EPDDGEINYPWLFRLFDEVGCEYK--------------------------
1a0cA           QFPTDIRMTTLAMYEVIKMGGFDKGGLNFDAKVRRASFEPEDLFLGHIAG--------------------
2hbvA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xx
1xp3A1          --
2g0wA1          --
1qtwA           --
1i60A           --
1k77A           --
1a0cA           --
2hbvA1          --