[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF55672.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1cjcA2.bssp"
#ERROR : Can't open dsspfile "1fcdA1.bssp"
#ERROR : Can't open dsspfile "1b73A1.bssp"
#ERROR : Can't open dsspfile "2hy5B1.bssp"
#ERROR : Can't open dsspfile "1xhcA1.bssp"
#ERROR : Can't open dsspfile "1yrwA2.bssp"
#ERROR : Can't open dsspfile "1do8A1.bssp"
#ERROR : Can't open dsspfile "1fmtA2.bssp"
#ERROR : Can't open dsspfile "1djnA3.bssp"
#ERROR : Can't open dsspfile "1h6vA2.bssp"
#ERROR : Can't open dsspfile "1dxlA2.bssp"
#ERROR : Can't open dsspfile "1gt8A4.bssp"
#ERROR : Can't open dsspfile "1qvvA.bssp"
#ERROR : Can't open dsspfile "1mo9A1.bssp"
#ERROR : Can't open dsspfile "1vqwA1.bssp"
#ERROR : Can't open dsspfile "1e4eA1.bssp"
#ERROR : Can't open dsspfile "1bwcA2.bssp"
#ERROR : Can't open dsspfile "1w4xA2.bssp"
#ERROR : Can't open dsspfile "1ps9A3.bssp"
#ERROR : Can't open dsspfile "1cjcA1.bssp"
#ERROR : Can't open dsspfile "1aogA2.bssp"
#ERROR : Can't open dsspfile "1bf3A1.bssp"
#ERROR : Can't open dsspfile "1gt8A3.bssp"
#ERROR : Can't open dsspfile "1f8rA1.bssp"
#ERROR : Can't open dsspfile "1fl2A2.bssp"
#ERROR : Can't open dsspfile "1gosA1.bssp"
#ERROR : Can't open dsspfile "1ks9A2.bssp"
#ERROR : Can't open dsspfile "1f8wA2.bssp"
#ERROR : Can't open dsspfile "1ltxR1.bssp"
#ERROR : Can't open dsspfile "1vqwA2.bssp"
#ERROR : Can't open dsspfile "1e0dA1.bssp"
#ERROR : Can't open dsspfile "1evyA2.bssp"
#ERROR : Can't open dsspfile "1f8wA1.bssp"
#ERROR : Can't open dsspfile "1d5tA1.bssp"
#ERROR : Can't open dsspfile "2ivdA1.bssp"
#ERROR : Can't open dsspfile "1eyzA2.bssp"
#ERROR : Can't open dsspfile "1f0yA2.bssp"
#ERROR : Can't open dsspfile "1w4xA1.bssp"
#ERROR : Can't open dsspfile "1txgA2.bssp"
#ERROR : Can't open dsspfile "1d7yA1.bssp"
#ERROR : Can't open dsspfile "1bncA2.bssp"
#ERROR : Can't open dsspfile "1bg6A2.bssp"
#ERROR : Can't open dsspfile "1nvmB1.bssp"
#ERROR : Can't open dsspfile "1cl0A2.bssp"
#ERROR : Can't open dsspfile "1i8tA1.bssp"
#ERROR : Can't open dsspfile "1sezA1.bssp"
#ERROR : Can't open dsspfile "1tltA1.bssp"
#ERROR : Can't open dsspfile "1bncA2.bssp"

## Summary of PDB Search
:455
    8e-16  23%  1cjcA2 [c.4.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:6 -- 106 A:332
    5e-14  15%  1fcdA1 [c.3.1.5] FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE (FLAVIN-
    1e-13  13%  1b73A1 [c.78.2.1] GLUTAMATE RACEMASE A:1 -- 105
    1e-13  10%  2hy5B1 [c.114.1.1] INTRACELLULAR SULFUR OXIDATION PROTEIN DSRF
    5e-12  21%  1xhcA1 [c.3.1.5] NADH OXIDASE /NITRITE REDUCTASE A:1 -- 103 A:226
    2e-11  10%  1yrwA2 [c.65.1.1] PROTEIN ARNA A:1 -- 203
    4e-11  15%  1do8A1 [c.2.1.7] MALIC ENZYME A:280 -- 573
    1e-10  15%  1fmtA2 [c.65.1.1] METHIONYL-TRNA FMET FORMYLTRANSFERASE A:1 -- 206
    2e-10  16%  1djnA3 [c.4.1.1] TRIMETHYLAMINE DEHYDROGENASE A:341 -- 489 A:646 --
    5e-10  15%  1h6vA2 [c.3.1.5] THIOREDOXIN REDUCTASE A:171 -- 292
    5e-10  16%  1dxlA2 [c.3.1.5] DIHYDROLIPOAMIDE DEHYDROGENASE A:153 -- 275
    1e-09  24%  1gt8A4 [c.4.1.1] DIHYDROPYRIMIDINE DEHYDROGENASE A:184 -- 287 A:441
    1e-09  12%  1qvvA  [c.23.16.2] YDR533C PROTEIN
    7e-09   8%  1mo9A1 [c.3.1.5] ORF3 A:2 -- 192 A:314 -- 383
    8e-09  28%  1vqwA1 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:3
    2e-08   9%  1e4eA1 [c.30.1.2] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE PROTEIN
    6e-08  14%  1bwcA2 [c.3.1.5] PROTEIN (GLUTATHIONE REDUCTASE) A:166 -- 290
    7e-08  18%  1w4xA2 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:155 -- 389
    1e-07  18%  1ps9A3 [c.4.1.1] 2,4-DIENOYL-COA REDUCTASE A:331 -- 465 A:628 --
    1e-07  29%  1cjcA1 [c.3.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:107 -- 331
    3e-07  11%  1aogA2 [c.3.1.5] TRYPANOTHIONE REDUCTASE A:170 -- 286
    6e-07  30%  1bf3A1 [c.3.1.2] P-HYDROXYBENZOATE HYDROXYLASE A:1 -- 173 A:276 --
    8e-07  28%  1gt8A3 [c.3.1.1] DIHYDROPYRIMIDINE DEHYDROGENASE A:288 -- 440
    1e-06  26%  1f8rA1 [c.3.1.2] L-AMINO ACID OXIDASE A:4 -- 319 A:433 -- 486
    3e-06  18%  1fl2A2 [c.3.1.5] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F A:326 --
    7e-06  13%  1gosA1 [c.3.1.2] MONOAMINE OXIDASE A:4 -- 289 A:402 -- 500
    1e-05  14%  1ks9A2 [c.2.1.6] 2-DEHYDROPANTOATE 2-REDUCTASE A:1 -- 167
    3e-05  16%  1f8wA2 [c.3.1.5] NADH PEROXIDASE A:120 -- 242
    3e-05   6%  1ltxR1 [c.3.1.3] RAB ESCORT PROTEIN 1 R:2 -- 444 R:558 -- 614
    4e-05  18%  1vqwA2 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:181
    4e-05  19%  1e0dA1 [c.5.1.1] UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
    5e-05  19%  1evyA2 [c.2.1.6] GLYCEROL-3-PHOSPHATE DEHYDROGENASE A:9 -- 197
    6e-05  17%  1f8wA1 [c.3.1.5] NADH PEROXIDASE A:1 -- 119 A:243 -- 321
    7e-05  19%  1d5tA1 [c.3.1.3] GUANINE NUCLEOTIDE DISSOCIATION INHIBITOR A:-2 --
    9e-05  32%  2ivdA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE A:10 -- 306 A:415 --
    1e-04  13%  1eyzA2 [c.30.1.1] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2 A:2
    2e-04   8%  1f0yA2 [c.2.1.6] L-3-HYDROXYACYL-COA DEHYDROGENASE A:12 -- 203
    2e-04  25%  1w4xA1 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:10 -- 154 A:390 --
    2e-04  12%  1txgA2 [c.2.1.6] GLYCEROL-3-PHOSPHATE DEHYDROGENASE [NAD(P)+] A:1
    2e-04   9%  1d7yA1 [c.3.1.5] FERREDOXIN REDUCTASE A:5 -- 115 A:237 -- 308
    3e-04   7%  1bncA2 [c.30.1.1] BIOTIN CARBOXYLASE A:1 -- 114
    3e-04  19%  1bg6A2 [c.2.1.6] N-(1-D-CARBOXYLETHYL)-L-NORVALINE DEHYDROGENASE
    6e-04  25%  1nvmB1 [c.2.1.3] ACETALDEHYDE DEHYDROGENASE (ACYLATING) B:1 --
    8e-04  13%  1cl0A2 [c.3.1.5] THIOREDOXIN REDUCTASE A:119 -- 244
    8e-04  17%  1i8tA1 [c.4.1.3] UDP-GALACTOPYRANOSE MUTASE A:1 -- 244 A:314 --
    9e-04  50%  1sezA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE, MITOCHONDRIAL A:13
    0.001  11%  1tltA1 [c.2.1.3] PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR MVIM A:5
    4e-04  10%  1bncA2 [c.30.1.1] BIOTIN CARBOXYLASE A:1 -- 114(query 144->237)
:455

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSRPLRVAVVGAGPAGIYASDLLMKSDTDVQIDLFERMPAPFGLIRYGVAPDHPRIKGIVKSLHNVMDKE
1cjcA2          -----QICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSD
1fcdA1          -----KVVVVGGGTGGATAAKYIKLADPSIEVTLIEPNTDYYTCYLSNEVIGGDRKLESIKHGYDGLRAH
1b73A1          ----MKIGIFDSGVGGLTVLKAIRNRYRKVDI--VYLGDTARV--PYGIRSKDTIIRYSLECAGFLKDKG
2hy5B1          -----KFMYLNRKAPYGTIYAWLIGAAFDQDVCVLFLDDGVYQLTRGQD-TKGIGMKNFSPTYRTLGDYE
1xhcA1          -----KVVIVGNGPGGFELAKQLSQTYEVTVIDKEPVPYYSKPMLSHYIAGFIPRNRLFPYSLDWYRKRG
1yrwA2          ----MKTVVFAYHDMGCLGIEALLAAGYEISA--IFTHTDFYGSVARLGIPVYAPDNVNHPLWVERIAQL
1do8A1          -----KILFLGAGEAALGIANLIVXSXVENGLSEQEAQKKIWXFDKYGL---------LVKGRKAKIDSY
1fmtA2          -SESLRIIFAGTPDFAARHLDALLSSGHNVVGV-FTQPDRPLMPEEKGLPVFQPV-SLRPQENQQLVAEL
1djnA3          TKNKDSVLIVGAGPSGSEAARVLMESGYTVHL--TDTAEKIGGHLNQAALPGLGEWSYHRDYRETQITKK
1h6vA2          -YCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVQIEA
1dxlA2          -EIPKKLVVIGAGYIGLEMGSVWGRIGSEV--TVVEFASEIVPTMDAEIRKQFQRSGMKFKLKTKVVGVD
1gt8A4          -AYSAKIALLGAGPASISCASFLARLGYS-DITIFEKQEYVGGLSTSEI-PQFRLPYDVVNFEIELMKDL
1qvvA           -----KVLLALTSYNDVFYSDGAKTVEALHPFNTFRKEGFEVDFVTGKFGWDEHSLAKDFLNGQDETDFK
1mo9A1          ----------------------------------------------------------------------
1vqwA1          LPTIRKIAIIGAGPSGLVTAKALLAEKAFDQVTLFERRGSPGGVWNYTSTLSN-----------------
1e4eA1          ---RIKVAILFGGCSEEHDVSVKSAIKEKYEPLYIGITKSGVWKMCEKPCAEWENENCYSAVLSPDKKMH
1bwcA2          -ELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRDKVLRSFDSMISTNCTEELENAGVEVLKFSQVTLS
1w4xA2          --SGQRVGVIGTGSSGIQVSPQIAKQAAEL--FVFQRTPHFAVPARNAEFLADLKKRYAEFREESRNTPG
1ps9A3          --QKKNLAVVGAGPAGLAFAINAAARGHQV--TLFDAHSEIGGQFNIAQIPGKEEFYETLR-----YYRR
1cjcA1          ----------------------------------------------------------------------
1aogA2          ---PRRVLTVGGGFISVEFAGIFNAYKPKDGQVTLCYRGEMILRGFDHTLREELTKQLTANGIQILTKEN
1bf3A1          -----QVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGKIRAGVLE-----QGMVDLLREAGVDR
1gt8A3          ----------------------------------------------------------------------
1f8rA1          -SNPKHVVIVGAGMAGLSAAYVLAGAGHQV--TVLEASERPGGRVRTYRNEEA----GWYANLGPMRLPE
1fl2A2          --KGKRVAVIGGGNSGVEAAIDLAGIVEHVTL--LEFAPEMKADQVLQDKLRSLKNVDIILNAQTTEVKG
1gosA1          -----DVVVVGGGISGMAAA--KLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRI
1ks9A2          ----MKITVLGCGALGQLWLTALCKQGHEV--QGWLRVPQPYCSVNLVETDGSIFNESLTANDPDFLATS
1f8wA2          --EVNNVVVIGSGYIGIEAAEAFAKAGKKV--TVIDILDRPLGVYLDKEFTDVLT-EEMEANNITIATGE
1ltxR1          LPSDFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQENTENSMWQEQ
1vqwA2          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1f8wA1          ----MKVIVLGSSHGGYEAVEELLNLHPDA--EIQWYEKGDFISFLSXGMQLYLEGKV------------
1d5tA1          ----------------------------------------------------------------------
2ivdA1          ----MNVAVVGGGISGLAVAHHLRSRGTDAV--LLESSARLGGAVG------------------------
1eyzA2          --AATRVMLLGSGELGKEVAIEC--QRLGVEVIAVDRYADAPAMHVAHR--SHVINMLDGDALRRVVELE
1f0yA2          ---VKHVTVIGGGLMGAGIAQVA--AATGHTVVLVDQTEDILAKSKKGIEESLRK-VAKKKFAENPKAGD
1w4xA1          -PEEVDVLVVGAGFSGLYALY--RLRELGRSVHVIETAGDVGGVWYWNRYP-------------------
1txgA2          ----------------------------------------------------------------------
1d7yA1          -ALKAPVVVLGAGLASVSFVAELRQAGYQGL--ITVVGDEAERPYDRPPLSKDFMAAEKIRLDCKRAPEV
1bncA2          -----KIVIANRGEIALRILRACKELGIKTVA--VHSSADRDLKHVLTVCIGPAPSVKSYLNIPAIISGA
1bg6A2          ----------------------------------------------------------------------
1nvmB1          MNQKLKVAIIGSGNIGDLMIKVLRNAKYLEMGAMVGIDAASDGLARMGVTTTYAGVEGL-----------
1cl0A2          --RNQKVAVIGGGNTAVEEALYLSNSEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGD
1i8tA1          -----DYIIVGSGLFGAVCANELKKLNKKVLV--IEKRNHIGGNAYTEDCEGIQIHKYIFHTNDKYIWDY
1sezA1          -----RVAVIGAGVSGLAAAYKLKI---------------------------------------------
1tltA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QLRFLGNIEVGKDITVEELREFYDAIVFSTGATGDQDLRVPGSDLEGSWGAGEFVGFYDGNPNFERNWDL
1cjcA2          RCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDKSRPIDPSVPFDPKLGVVPNMEGRVVDVLYCSGWVK
1fcdA1          GIQVVHDSATGIDPDKKLVKTAYDRCVVAPGIELIYDK-IEQRAGKIAQIAGLTNDAGWCPVDIKTFESS
1b73A1          VDIIVVACNTASAYALERLKKEINVPVFGVIEPGVKEALKKS----------------------------
2hy5B1          VRRIYVDRDSLEARGLTQ----DDLVEIAFEDMETEEEFDNIVEVIDSARVSELMNESDAVFSF------
1xhcA1          IEIRLAEEAKLIDRGREKGEVPYDTLVLATGAPNVDLARRSGIHTGRGILIDDN--FRTSAKDVYAIGDC
1yrwA2          SPDVIFSFYYRHLIYDEILQLAPAGAFNLHGSLLPKYRGRAPLNWVLVNGETETGVTLHRMVKRADAGAI
1do8A1          QEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAXASINERPVIFALSNPTAQAECT--
1fmtA2          QADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDM
1djnA3          NKESQLALGQKPMTADDVLQYGADKVIIATGASKARESEWAENDIKGIYLIGDAEA--------------
1h6vA2          GTPGRLKVTAKSTNSEETIEDEFNTVLLAVG---------------------------------------
1dxlA2          TSGDGVKLTVEPSAGGEQTIIEADVVLVS-----------------------------------------
1gt8A4          GVKIICGKSLSNEITLNTLKEGYKAAFIGIGLP--EVLRDPK----------------------------
1qvvA           NKDSDFNKTLAKIKTPKEVNADYQIFFASAGHGTLFDYPKAKDLQDI-----------------------
1mo9A1          ------WNARNDHLTINQWATRIDEILEAPDGG-EVIYNVDENDPREYDAI--FIGGAAGRFGSAYLRAM
1vqwA1          ----------------------------------------------------------------------
1e4eA1          GLLV--------KKNHEYEINHVDVAFSALHGKSGEDGSIQG----------------------------
1bwcA2          GLEVSMVTAVPGRLPVMTMIPDVDCLLWAIG---------------------------------------
1w4xA2          GTHRYQGPKSALEVSDEELVETLERYWQEGGPDILAAYRDILRDRDANERVAEF----------------
1ps9A3          MIEVTGVTLKLNHTVTADQLQAFDETILASGIP----------------------NRALAQPLIDSG---
1cjcA1          ----------------------------------HQALDIPGEELPGVFSARAFVGWYNGLPERELAPDL
1aogA2          PAKVELNADGSKSVTFESGKKMFDLVMMA-----------------------------------------
1bf3A1          RMARDGLVHEGVEIAFAGQRRRIDLKRLSGG---------------------------------------
1gt8A3          ----------------------------------------------------------------------
1f8rA1          KHRIVREYIRKFDLRLNEFSQENDN---------------------------------------------
1fl2A2          DGSKVVGLEYRDRVSGDIHNIELAGIFVQIG---------------------------------------
1gosA1          L-RLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDD-------------
1ks9A2          DLLLVTLKAWQVSDAVKSLASTLTTPILLIHNGMGTIEELQNIQQPLLMGTTTHAARRDGNVIIHV----
1f8wA2          TVERYEGDGRVQKVVTDKNAYDADLVVVA-----------------------------------------
1ltxR1          ILENEEAIPLSSKTIQHVEVFCYASQDKNRITYSQIIKEGRRFNIDLVSKLLYSRGLLIDLLIKSNVSRY
1vqwA2          ---------------------------------------IKGLDEYAKAVPGSVLHSSL----FREPELF
1e0dA1          --------------------------------------------------------------------DY
1evyA2          -----------------------------------------------------------------KDELL
1f8wA1          ----------------------------------------------------------------------
1d5tA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1eyzA2          KPHYIVPEIEAIATDMLIQLEEEGLNVVPCARATKLTM--------------------------------
1f0yA2          EFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANAT
1w4xA1          ----------------------------------------------------------------------
1txgA2          ----------------------------------------------------------------------
1d7yA1          EWLLGVTAQS------------------------------------------------------------
1bncA2          VAIHPGYGFLSENANFAEQVERSGFIFIGPKAETIRLM--------------------------------
1bg6A2          ----------------------------------------------------------------------
1nvmB1          ----------------------------------------------------------------------
1cl0A2          QMGVTGVRLRDTQNSDNIESLDVAGLFVAIG---------------------------------------
1i8tA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1tltA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SAEKVAVVGVGNVALDVARILAKTGDELLVTEIPDNVYESLAKNQAKEVHVFGRRGPAQAKFTPLELKEL
1cjcA2          RGPTGVITTTMTDSFLTGQILLQDLAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEKLDAEEVSRGQA
1fcdA1          IHKGIHVIGDASIANPMPKSGYSANSQ-------------------------------------------
1b73A1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1xhcA1          AEYSGIIAGTAKAAMEQARVLADI----------------------------------------------
1yrwA2          VAQLRIAIAPDDIAITLHHKLCHAARQLLEQTLPA-----------------------------------
1do8A1          ----------------------------------------------------------------------
1fmtA2          LYKLSCPITAEDTSGTLYDKLAELGPQGLIT-----TLKQLADGTAKPEV--------------------
1djnA3          ---PRLIADATFTGHRVAREIEEANPQIAIPYKRETI---------------------------------
1h6vA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1qvvA           ----------------------------------------------------------------------
1mo9A1          GGRQLIVDRWPFLGGSCPHNACVPHHLFSDCAAELMLARTFSGQYWFPDM--------------------
1vqwA1          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1ps9A3          --KTVHLIGGCDVAMELDARRAI-----------------------------------------------
1cjcA1          SCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREM
1aogA2          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1gt8A3          ---AVIVLGAGDTAFDCATSALRCG--------------------ARRVFLVFRKGFVNIRAVPEEV---
1f8rA1          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
1ks9A2          -ANGITHIGPARQQDGDYSYLADIL---------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1ltxR1          AEFKNITRILAFREGTVEQVPCSRADVFNSKQLTMVEKRMCVEYEEHPDEYRAYEG---TTFSEYLKTQK
1vqwA2          VGESVLVVGGASSANDLVRHLTPVAKHPIYQSLLGGGDIQNESLQQVPEIT-------------------
1e0dA1          QGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLDKLPEAVERHTG------------------
1evyA2          YLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKREN-----------------------
1f8wA1          ----------------------------------------------------------------------
1d5tA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1f0yA2          TRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSC-------------------
1w4xA1          ----------------------------------------------------------------------
1txgA2          ---IVSILGAGAMGSALSVPLVDNGNEVRIWGTEFDTEILKSISAGREHPRLGVKLNGVEIFWPELEKCL
1d7yA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1bg6A2          ---TYAVLGLGNGGHAFAAYLALKGQSVLAWDIDAQRIKEIQDRGAIIAEGPGLAGTAHPDLLTSDIGLA
1nvmB1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1tltA1          ---RIGVVGLGGIAQKAWLPVLAAASDWTLQGAWSPTRAKALPICES-----------------------
1bncA2          ---KIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNIPAIISAA


                         .         .         .         +         .         .         .:280
query           DHSDTIEVIVNPEDIDYDAASEQARRDSKSQDLVCQTLESYAMRDPKGAPHKLFIHFFESPVEILGEDGK
1cjcA2          SGKPREKLLDPQEM--------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1do8A1          ----------------------------------------------------------------------
1fmtA2          ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1qvvA           ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1cjcA1          IQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAARRWGLRFFRSPQQVLPSPAG
1aogA2          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1gt8A3          ---------------------ELAKEE------------------------KCEFLPFLSPRKVIVKGGR
1f8rA1          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1ltxR1          LTPNLQYFVLHSIAMSTSCTVDGLKATKKFLQCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLR
1vqwA2          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1d5tA1          ------------------------------------------------------YMLNKPVDDIIMENGK
2ivdA1          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1w4xA1          ----------------------------------------------------------------------
1txgA2          ENAEVVLLGVSTDGVLPVMSRILPYLKDQYIVLISKGTVPEAVWRLKHDLRERT--VAITGPAIAREVAK
1d7yA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1bg6A2          VKDADVILIVVPAIHHASIAANIASYISEGQLIILNALEFRKILRENGAPEVTIETSSLFTCRSERPGQV
1nvmB1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1tltA1          ----------------------------------------------------------------------
1bncA2          EITGAVAIHPGYGFLSENANFAEQVER-------------------------------------------


                         .         *         .         .         .         .         +:350
query           VVGLKTERTQLDGNGGVTGTGEFKTWDVQSVYRAVGYRSDAIEGVPFDDERAVVPNDGGHIIDPEVGSPI
1cjcA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1do8A1          ----------------------------------------------------------------------
1fmtA2          ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1qvvA           ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1cjcA1          IRLAVTRLEGIGEATRAVPTGDVEDLPCGLVLSSIGY---------------------------------
1aogA2          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1gt8A3          IVAVQFVRTEQDETGWNEDEDQIVHLKADVVISAFG----------------------------------
1f8rA1          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1ltxR1          HSVQCLVVDKESRKCKAVIDQFGQRIISKHFIIEDSYLSENT---CSRVSRDCYNDLPSNVYVCSGPDGL
1vqwA2          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1d5tA1          VVGVKSE-------------GE--VARCKQLICDPSYVPDRVPIDDGSESQVFCSCSYDATHFETTCNDI
2ivdA1          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1w4xA1          ----------------------------------------------------------------------
1txgA2          RMPTTV----------VFSSPSESSANMKEIFETEYFG--------------------------------
1d7yA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1bg6A2          TVNAIKGA--------------------------------------------------------------
1nvmB1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1tltA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TGLYATGWIKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1cjcA2          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1do8A1          ----------------------------------------------------------------------
1fmtA2          ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1qvvA           ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1gt8A3          ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1ltxR1          GNDNAVKQAE------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1d5tA1          KDIYKRM---------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1w4xA1          ----------------------------------------------------------------------
1txgA2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
1nvmB1          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1tltA1          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1cjcA2          -----------------------------------
1fcdA1          -----------------------------------
1b73A1          -----------------------------------
2hy5B1          -----------------------------------
1xhcA1          -----------------------------------
1yrwA2          -----------------------------------
1do8A1          -----------------------------------
1fmtA2          -----------------------------------
1djnA3          -----------------------------------
1h6vA2          -----------------------------------
1dxlA2          -----------------------------------
1gt8A4          -----------------------------------
1qvvA           -----------------------------------
1mo9A1          -----------------------------------
1vqwA1          -----------------------------------
1e4eA1          -----------------------------------
1bwcA2          -----------------------------------
1w4xA2          -----------------------------------
1ps9A3          -----------------------------------
1cjcA1          -----------------------------------
1aogA2          -----------------------------------
1bf3A1          -----------------------------------
1gt8A3          -----------------------------------
1f8rA1          -----------------------------------
1fl2A2          -----------------------------------
1gosA1          -----------------------------------
1ks9A2          -----------------------------------
1f8wA2          -----------------------------------
1ltxR1          -----------------------------------
1vqwA2          -----------------------------------
1e0dA1          -----------------------------------
1evyA2          -----------------------------------
1f8wA1          -----------------------------------
1d5tA1          -----------------------------------
2ivdA1          -----------------------------------
1eyzA2          -----------------------------------
1f0yA2          -----------------------------------
1w4xA1          -----------------------------------
1txgA2          -----------------------------------
1d7yA1          -----------------------------------
1bncA2          -----------------------------------
1bg6A2          -----------------------------------
1nvmB1          -----------------------------------
1cl0A2          -----------------------------------
1i8tA1          -----------------------------------
1sezA1          -----------------------------------
1tltA1          -----------------------------------
1bncA2          -----------------------------------