[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF55698.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f89A.bssp"
#ERROR : Can't open dsspfile "1j31A.bssp"
#ERROR : Can't open dsspfile "1erzA.bssp"
#ERROR : Can't open dsspfile "1qwyA.bssp"
#ERROR : Can't open dsspfile "1xkpA1.bssp"
#ERROR : Can't open dsspfile "1y44A1.bssp"

## Summary of PDB Search
:266
    7e-46  29%  1f89A  [d.160.1.1] 32.5 KDA PROTEIN YLR351C
    2e-43  29%  1j31A  [d.160.1.2] HYPOTHETICAL PROTEIN PH0642
    9e-43  25%  1erzA  [d.160.1.2] N-CARBAMYL-D-AMINO ACID AMIDOHYDROLASE
    8e-05  16%  1qwyA  [b.84.3.2] PEPTIDOGLYCAN HYDROLASE
    9e-05  19%  1xkpA1 [a.243.1.3] PUTATIVE MEMBRANE-BOUND YOP TARGETING PROTEIN
    5e-04  34%  1y44A1 [d.157.1.7] RIBONUCLEASE Z A:1 -- 307
:266

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGEFSTAVKELA
1f89A           IKVALVQLSGSSDKMANLQRAATFIERAMKEDTKLVVLPECFNSPYSTDQFRKYSEVIPSTSVQFLSNLA
1j31A           VKVGYIQXEPKIELDKNYSKAEKLIKEASKEGAKLVVLPELFDTGYNFEVFDVAQQIPEGETTTFLXELA
1erzA           MILAVGQQGPAETREQVVVRLLDMLTKAASRGANFIVFPELALTTFFPRWHFTDETEMPGPVVRPLFEKA
1qwyA           ----------------------------------------------------------------------
1xkpA1          -----------------------------------------------------ELAHLSHLVEQALVSMA
1y44A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQGYNKIHTYDAFGYRESDTVKPGDELVVFE
1f89A           NKFKIILVGGTIPELD-----PKTDKIYNTSIIFNEDGLIDKHRKVHLF-----HESETLSPGEKSTTID
1j31A           RELGLYIVAGTA---------EKSGNYLYNSVVVGPRGYIGKYRKIHLF----YREKVFFEPGDLFKVFD
1erzA           AELGIGFNLGYAELVVEGGVK----RRFNTSILVDKSGKIVGKYKIHAYRPFQHLEKRYFEPGDLFPVYD
1qwyA           ---NSPVYS----LTDTVVQAGWSNYGGGNQVTI----KEANSNNYQWYNRLTVSAGDKVKAGDQIAYSG
1xkpA1          EEQGETIVLG------ARITPEAYR--ESQSGVNPLQPLRDTYRDAVMGYQGIYAIWSDLQNGDIDSV--
1y44A1          ---------------------------------------------IHGVEAFGYRVQEKDVPGSLL---E


                         +         .         .         .         .         *         .:210
query           VDDIKFGVATCYDIRFPEQFKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARL
1f89A           TKYGKFGVGICYDMRFPELAMLSARKGAFAMIYPSAFNTVTGP-LHWHLLARSRAVDNQVYVMLCSPA--
1j31A           IGFAKVGVXICFDWFFPESARTLALKGAEIIAHPANL--------VXPYAPRARALENRVYTITADRV--
1erzA           VDAAKMGMFICNDRRWPEAWRVMGLRGAEIICGGYNTPTHNPPSFHHLLSMQAGSYQNGAWSAAAGKV--
1qwyA           STGNSTAPHVHFQRMSGGIGNQYAVDPTSYL---------------------------------------
1xkpA1          ----------------------------------------------------------------------
1y44A1          PPKKGRSVVFSGDTRVSDKLKELAR-DCDVXVHEATFAKEDRKL--------------------------


                         .         .         .         +         .         .         .:280
query           PEELRDKRNGPTGIGHSMVANPHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPVL
1f89A           ----RNLQSSYHAYGHSIVVDPRGKIVAEAGEGEEIIYAELDPEVIESFRQAVPLT
1j31A           -----GEERGLKFIGKSLIASPKAEVLSIASETEEEIGVDLNLARNKRLNDXNDIF
1erzA           -----GMEENCMLLGHSCIVAPTGEIVALTTTEDEVITAAVDLDRCRELREHIFNF
1qwyA           --------------------------------------------------------
1xkpA1          --------------------------------------------------------
1y44A1          --------------------------------------------------------