[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF55730.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1q7l.1.bssp"
#ERROR : Can't open dsspfile "1vgyA1.bssp"
#ERROR : Can't open dsspfile "1ampA.bssp"
#ERROR : Can't open dsspfile "1cg2A1.bssp"
#ERROR : Can't open dsspfile "1lfwA1.bssp"
#ERROR : Can't open dsspfile "1lfwA2.bssp"
#ERROR : Can't open dsspfile "1r3nA1.bssp"
#ERROR : Can't open dsspfile "1ysjA2.bssp"
#ERROR : Can't open dsspfile "1y7eA2.bssp"
#ERROR : Can't open dsspfile "1cx8A3.bssp"
#ERROR : Can't open dsspfile "1vgyA2.bssp"
#ERROR : Can't open dsspfile "1cg2A2.bssp"
#ERROR : Can't open dsspfile "1r3nA2.bssp"
#ERROR : Can't open dsspfile "1vheA2.bssp"
#ERROR : Can't open dsspfile "1hf2A2.bssp"
#ERROR : Can't open dsspfile "1z2lA2.bssp"
#ERROR : Can't open dsspfile "1xfoA2.bssp"
#ERROR : Can't open dsspfile "1xmbA2.bssp"

## Summary of PDB Search
:441
    5e-18  19%  1q7l.1 [c.56.5.4] AMINOACYLASE-1 A:- -- - B:- -- -
    7e-17  26%  1vgyA1 [c.56.5.4] SUCCINYL-DIAMINOPIMELATE DESUCCINYLASE A:2 -- 180
    8e-14  10%  1ampA  [c.56.5.4] AMINOPEPTIDASE
    4e-12  19%  1cg2A1 [c.56.5.4] CARBOXYPEPTIDASE G2 A:26 -- 213 A:327 -- 414
    6e-11  19%  1lfwA1 [c.56.5.4] PEPV A:1 -- 186 A:383 -- 468
    6e-09  13%  1lfwA2 [d.58.19.1] PEPV A:187 -- 382
    3e-08  11%  1r3nA1 [c.56.5.4] BETA-ALANINE SYNTHASE A:18 -- 247 A:364 -- 455
    8e-08  21%  1ysjA2 [d.58.19.1] PROTEIN YXEP A:178 -- 292
    9e-08  11%  1y7eA2 [c.56.5.4] PROBABLE M18-FAMILY AMINOPEPTIDASE 1 A:4 -- 100
    2e-07   9%  1cx8A3 [c.56.5.5] TRANSFERRIN RECEPTOR PROTEIN A:122 -- 189 A:383
    6e-07  13%  1vgyA2 [d.58.19.1] SUCCINYL-DIAMINOPIMELATE DESUCCINYLASE A:181 --
    5e-06  22%  1cg2A2 [d.58.19.1] CARBOXYPEPTIDASE G2 A:214 -- 326
    1e-05  11%  1r3nA2 [d.58.19.1] BETA-ALANINE SYNTHASE A:248 -- 363
    3e-05  14%  1vheA2 [c.56.5.4] AMINOPEPTIDASE/GLUCANASE HOMOLOG A:3 -- 72 A:163
    9e-05  13%  1hf2A2 [c.102.1.1] SEPTUM SITE-DETERMINING PROTEIN MINC A:1 -- 99
    1e-04  18%  1z2lA2 [d.58.19.1] ALLANTOATE AMIDOHYDROLASE A:213 -- 329
    1e-04  11%  1xfoA2 [c.56.5.4] FRV OPERON PROTEIN FRVX A:6 -- 72 A:164 -- 353
    8e-04  13%  1xmbA2 [d.58.19.1] IAA-AMINO ACID HYDROLASE HOMOLOG 2 A:216 -- 334
:441

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLYDETLTLLQELIRNACVNDLTPDSGQEIRNAESLERFFEGTPNVEITKLEPRPGRTSIIVTVPGSDP
1q7l.1          ----HPSVTLFRQYLRIRTVQP----KPDYGAAVAFFEETARQL-GLGCQKVEVAPGYVVTVLTWPGTNP
1vgyA1          ----TQSLELAKELISRPSVTP--DDRDCQKLXAERLHKIG-------FAAEEXHFGNTKNIWLRRGTKA
1ampA           ----SQITGTISSLESFTNRFYTTT---SGAQASDWIASEWQAPNASVKQVSHSGYNQKSVVMTITGSEA
1cg2A1          ----PAVIKTLEKLVN---IETGTGDAEGIAAAGNFLEAELKNLGTVTRSKSAGLVVGDNIVGKIKGRGG
1lfwA1          --KKDAILKDLEELIAIDSSED-LENATEEYPVGKGPVDAMTKFLS-FAKRDGFDTENFANYAGRVNFGA
1lfwA2          ----------------------------------------------------------------------
1r3nA1          ----------------------------------------------------------------------
1ysjA2          ----------------------------------------------------------------------
1y7eA2          ----NQILNFSESYKKFISKFKTEREVTAYALDKLGFINAEEKKNLXPGDKIFYTCREKSVAFAIIGKNP
1cx8A3          ----------------------------------------------------------------------
1vgyA2          ----------------------------------------------------------------------
1cg2A2          ----------------------------------------------------------------------
1r3nA2          ----------------------------------------------------------------------
1vheA2          ----DETLTXLKDLTDAKGI------PGNEREVRQVXKSYIEPF-ADEVT----TDRLGSLIAKKTGAEN
1hf2A2          ------------------------------------------------------GDRISLMIENHNKHSQ
1z2lA2          ----------------------------------------------------------------------
1xfoA2          -----VDYELLKKVVEAPGV------SGYELGIRDVVIEEIKDY-VDEVK----VDKLGNVIAHKKGEGP
1xmbA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NAEPLTLLGHTDVVPVDLPKWTKDPFGAEISDGQIWGRGSVDMLFIXXXXXXXXXXXXXEGGLRGTLTFV
1q7l.1          TLSSILLNSHTDVVPVFKEHWSHPFEAFKDSEGYIYARGAQDMCVSIQYLEAVRRLKVEGHRFPRTIHMT
1vgyA1          --PVVCFAGHTDVVPTGPVEWDSPPFEPAERDGRLYGRGAADXKSIACFVTACERFVAKHPNHQGSIALL
1ampA           PDEWIVIGGHLDSTIGSHTNEQS------------VAPGADDDSGIAAVTEVIRVLSENNFQPKRSIAFM
1cg2A1          --KNLLLMSHMDTVYLK-GILAKAPFRVE--GDKAYGPGIADDKGNAVILHTLKLLKEYGVRDYGTITVL
1lfwA1          GDKRLGIIGHMDVVPAG-EGWTRDPFKMEIEEGRIYGRGSADDGPSLTAYYGMLLLKEAGFKPKKKIDFV
1lfwA2          ----------------------------------------------------------------FTLEFS
1r3nA1          -----KVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGLGVLAGLEVLRTFKDNNYVPNYDVCVV
1ysjA2          ----------------------------------------------------------------------
1y7eA2          IEDGXNFIVHTDSPRVPAGTAKDVGF-----DKALIGAYGQDDKICVFTSLESIFDLEETP--NKTAICF
1cx8A3          --------KILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKALLLKLAQMFSDMVLKDGFQPSRSIIFA
1vgyA2          ----------------------------------------------------------------------
1cg2A2          ----------------------------------------------------------------------
1r3nA2          ----------------------------------------------------------------------
1vheA2          -GPKIXIAGHLDEVPHFEFTVXNNE-------KFLLAKAWDNRIGCAIAIDVLRNLQ--NTDHPNIVYGV
1hf2A2          --DIPRIVSHLRNLG---------LEVSQILVGKVQSRTTVE----------------------------
1z2lA2          ----------------------------------------------------------------------
1xfoA2          K---VMIAAHMDQIW---------DGRLERLGKHRFVSIAFDDRIAVYTILEVAKQLKD---AKADVYFV
1xmbA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GVADEEARGGLGAKWLSEEHQNLFSWKNCLSESGGSHLPVHDGSDAVVINVGEKGAAQRRIHVNGDAGHG
1q7l.1          FV-PDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANP----TDAFTVFYSERSPWWVRVNPWWAAFSR
1vgyA1          ITSDEEGDALDGTTKVVD----------------------------------------------------
1ampA           AYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTN-YKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPS
1cg2A1          FNTDEEK-GSFGSRDLIQEEAKL--ADYVLSFE-----PTSAGDEKLSLGTFNAGEGGKKLVDKAVAYYK
1lfwA1          LGTNEET-NWVGIDYYLKHE-----PTPDIVFSPDAEYPIINGEHVPGSDPMVQTLLKVYEKQTGKPGHE
1lfwA2          FKNDDTKGDYVLDKFKAGIATNVRATISGPDLEAVKLAYESFLADKELDGSFEINDESADIVLIGQGAHA
1r3nA1          VWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDK-----------PESVYDSLKNIGYIGDTPAS
1ysjA2          ----------------------------------------------------------------------
1y7eA2          LV-DKEEIDSRYLEYFVSD--XIFKIKKS---EYNNLHVQKALWNSKSISADVCAAINPEQNAPQLGYGI
1cx8A3          SWSAGDFGSVGATEWLEGYLSSLHLK------------------AFTYINLDKAVLGTSNFKVSASPLLY
1vgyA2          -----------------------------------------------------------NLTVKGKQGHI
1cg2A2          ----------------------------------------------------------------------
1r3nA2          ------------------------------------------------------AYNWQKVTVHGVGAHA
1vheA2          GTVQEEVGLRGAKTAAHTIQPDIA------FGVDVGIAGDTPGISEKEAQSKXGKGPQIIVYDASXVSH-
1hf2A2          ----------------------------------------------------------------------
1z2lA2          ----------------------------------------------------------------------
1xfoA2          ATVQEEVGLRGARTSAFGIEPDYG----FAIDVTIAADIPGTPEHKQVTHLGKGTAIKIMDRSVICHPTI
1xmbA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SIPFDRDSAIVKIGEVARRIAAADLKVAKDDIWQGFVQAHRFDPETEQALLSGTSPEAYAEFGGLSRFAH
1q7l.1          VCKDMNLTLEPEIMPAAGDNRYI-----------------------------------------RAVGVP
1vgyA1          ----------------------------------------------------------------------
1ampA           LTYGFDTCGYACSDHASWHNAG--------------YPAAMPFESK---------------FNDYNPRIH
1cg2A1          EAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYH--SDKAEYVDISAIPRRLY-----------
1lfwA1          VVIGGGTYGR------------------------------------------------------------
1lfwA2          SAPQVGKNSATFLALFLDQY-----------------AFAGRDKNFLHFL-----AEVEHEDFYGKKLGI
1r3nA1          YKE---NEIDAHFELHIEQGPILEDENKAIGIVTGVQAVNFHEVCIECVSRSAFAQFKKDQV----RQIW
1ysjA2          ----------------------------------------------------------------AGQIIS
1y7eA2          PIXKYTDAELVSY--IRQLLNKNNIAWQVATLGKGGTVAKFLAGYGIRTIDXGP-AVISXEITSKFDLYN
1cx8A3          TLIEK------TMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFP------------------------
1vgyA2          AYPHLAINPVHTFAPALLELTQE----------------------------------------VWDEGNE
1cg2A2          ---------------------------------------------------AGAAPEASDLVLRTMNIDD
1r3nA2          GTTPW-RLRKDALLMSSKMIVA--------------ASEIAQRHNGL-----------------------
1vheA2          ------------------------------------KGLRDAVVATAEEAGIPYQFDAIAGGGTDSGAIH
1hf2A2          ----------------------------------------------------------------------
1z2lA2          ---------------------------------------------------------------------R
1xfoA2          VRWLEELAKKHEIPYQ------------------------------------------------LEILLG
1xmbA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AVSHLTIAQTVVRAGQAINVLPSHAYLELDIRTLPGQTNDYVDDTLRGALGDLADEVEIEHLISEEATVS
1q7l.1          ALGFSPMNRTPVLLHDHDERLHEAVFLR-GVDIY------------------------------------
1vgyA1          ----------------------------------------------------------------------
1ampA           -----------TTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSAT-------------------------
1cg2A1          ----------------------------------------------------------------------
1lfwA1          ----------------------------------------------------------------------
1lfwA2          FHHDDLMGDLASSPSMFDYEHAGKASLLNNVRYPQGTDPDTMIKQVLDK---FSGILDVTYNGFEE----
1r3nA1          SGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEENGFKVLLQAIINYDNYRVIR----------
1ysjA2          GLQNAVVSITRVQAGTSWNVIPDQAEXEGTVRTFQKEARQAVPEHXRRVAEGIAAGYGAQ----------
1y7eA2          AYLAYK----------------------------------------------------------------
1cx8A3          ---------FLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHD
1vgyA2          YFPPTSFQISNINGGTATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQ----
1cg2A2          KAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLDVKVIV---------
1r3nA2          -----FTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKI--------------
1vheA2          LTAN---------GVPALSITIATRYIHTHAAXLHRDDYENAVKLITEVIKKLDRK-TVDEITYQE----
1hf2A2          ----------------------------------------------------------------------
1z2lA2          MGDPLVLTFGKVEPRPTVNVVPGKTTFTIDCRHTDAAVLRDFTQQLENDMRAICDEMDIGIDIDLWMDEE
1xfoA2          GGTDAGAIHLTKAGVPTGALSVPARYIHSNTEVVDERDVDATVELMTKALENIHEL--------------
1xmbA2          ------------------KVNPDSITIGGTLRAFTGFTQQRVKEVITKQAAVHRCNASVNLTPNGREPMP


                         .         .         .         .         *         .         .:420
query           Pxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1q7l.1          ----------------------------------------------------------------------
1vgyA1          ----------------------------------------------------------------------
1ampA           ----------------------------------------------------------------------
1cg2A1          ----------------------------------------------------------------------
1lfwA1          ----------------------------------------------------------------------
1lfwA2          ----------------------------------------------------------------------
1r3nA1          ----------------------------------------------------------------------
1ysjA2          ----------------------------------------------------------------------
1y7eA2          ----------------------------------------------------------------------
1cx8A3          V---------------------------------------------------------------------
1vgyA2          ----------------------------------------------------------------------
1cg2A2          ----------------------------------------------------------------------
1r3nA2          ----------------------------------------------------------------------
1vheA2          ----------------------------------------------------------------------
1hf2A2          ----------------------------------------------------------------------
1z2lA2          P---------------------------------------------------------------------
1xfoA2          ----------------------------------------------------------------------
1xmbA2          P---------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxx
1q7l.1          ---------------------
1vgyA1          ---------------------
1ampA           ---------------------
1cg2A1          ---------------------
1lfwA1          ---------------------
1lfwA2          ---------------------
1r3nA1          ---------------------
1ysjA2          ---------------------
1y7eA2          ---------------------
1cx8A3          ---------------------
1vgyA2          ---------------------
1cg2A2          ---------------------
1r3nA2          ---------------------
1vheA2          ---------------------
1hf2A2          ---------------------
1z2lA2          ---------------------
1xfoA2          ---------------------
1xmbA2          ---------------------