[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cglu2:BAF55908.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fjcA1.bssp"
#ERROR : Can't open dsspfile "1mojA.bssp"
#ERROR : Can't open dsspfile "1uvhA1.bssp"
#ERROR : Can't open dsspfile "1o22A.bssp"
#ERROR : Can't open dsspfile "1dpsA.bssp"
#ERROR : Can't open dsspfile "1ji4A.bssp"
#ERROR : Can't open dsspfile "1ji5A.bssp"
#ERROR : Can't open dsspfile "1z6oM1.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1bcfA.bssp"
#ERROR : Can't open dsspfile "1b71A1.bssp"
#ERROR : Can't open dsspfile "1aewA.bssp"
#ERROR : Can't open dsspfile "1nf4A.bssp"
#ERROR : Can't open dsspfile "1z6oA1.bssp"

## Summary of PDB Search
:165
    3e-36  22%  2fjcA1 [a.25.1.1] ANTIGEN TPF1 A:27 -- 177
    6e-34  26%  1mojA  [a.25.1.1] DPS-LIKE FERRITIN
    8e-21  55%  1uvhA1 [a.25.1.1] STARVATION-INDUCED DNA PROTECTING PROTEIN A:5 --
    4e-18   8%  1o22A  [d.238.1.1] ORPHAN PROTEIN TM0875
    6e-15  36%  1dpsA  [a.25.1.1] DPS
    6e-14  23%  1ji4A  [a.25.1.1] NEUTROPHIL-ACTIVATING PROTEIN A
    7e-14  29%  1ji5A  [a.25.1.1] DLP-1
    7e-12  10%  1z6oM1 [a.25.1.1] FERRITIN HEAVY CHAIN M:1 -- 191
    2e-11   8%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    3e-11  15%  1bcfA  [a.25.1.1] BACTERIOFERRITIN
    2e-10   7%  1b71A1 [a.25.1.1] PROTEIN (RUBRERYTHRIN) A:1 -- 147
    8e-10  13%  1aewA  [a.25.1.1] FERRITIN
    1e-09  18%  1nf4A  [a.25.1.1] BACTERIOFERRITIN
    1e-06   8%  1z6oA1 [a.25.1.1] FERRITIN LIGHT CHAIN A:13 -- 212
:165

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANYTVPGINENDAKQLIDGLQERLTDYNDLHLILKHVHWNVTGPNFIAVHEMLDPQVDLVRGYADEVAE
2fjcA1          ----------ARAIAAICEQLRQHVADLGVLYIKLHNYHWHIYGIEFKQVHELLEEYYVSVTEAFDTIAE
1mojA           VEGSDALRMDADRAEQCVDALNADLANVYVLYHQLKKHHWNVEGAEFRDLHLFLGEAAETAEEVADELAE
1uvhA1          ----TIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
1o22A           ----------------------------------ILEILYYKKGKEFGILEKKXKEIFNETGVSLEPVNS
1dpsA           ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
1ji4A           ---------------KTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAE
1ji5A           ---------------QVIEVLNKQVADWSVLFTKLHNFHWYVKGPQFFTLHEKFEELYTESATHIDEIAE
1z6oM1          --------IPKDMHRSCRNSMRQQIQMGASLQYLAMGAHFSKDVVNRPGFAQLFFDAASEEREHAMKLIE
1zs3A1          ------------------------------ENIRLTQAGIYAKSP---VKCEYLREIAQREVEYFFKISD
1bcfA           -----------KGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIE
1b71A1          ---------KSLKGSRTEKNILTAFAGESQARNRYNYFGGQAKKDGFVQISDIFAETADQEREHAKRLFK
1aewA           --------IRQNYSTEVEAAVNRLVNLLRASYTYLSLFYFDRDDVALEGVCHFFRELAEEKREGAERLLK
1nf4A           ---------REDRKAKVIEVLNKARAMELHAIHQYMNQHYSLDDMDYGELAANMKLIAIDEMRHAENFAE
1z6oA1          --------GEYGSHGNVATELQAYAKLERSYDYLLSAAYFNNYQTNRAGFSKLFKKLSDEAWSKTIDIIK


                         .         .         *         .         .         .         .:140
query           RISTLGGAPVGTPEGHVADRTPLQYERNAGNAQAHLTDLNRVYTQVLTGVRESMASAGPVDPVTEDIYIG
2fjcA1          RLLQLGAQAPASMAEYLALSGIAEETEKEITIVSALARVKRDFEYLSTRFSQTQVLAAESDAVTDGIITD
1mojA           RVQALGGVPHASPETLQAEASVDVEDEDVYDIRTSLANDMAIYGDIIEATREHTELAENLDHATAHMLRE
1uvhA1          RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
1o22A           ELIGRIFLKISVLEGEEVPSFAIKALTPKENAVDLPLG---DWTDLKNVFVEEIDYLDSYGDXKILSEKN
1dpsA           RAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAIVANDVRKAIGEAK--DDDTADILTA
1ji4A           RIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEDKVTVTYADD
1ji5A           RILAIGGKPVATMKEYLEISSEAAYGETAEGMVEAIMKDYEMMLVELKKGMEIAQNSD--DEMTSDLLLG
1z6oM1          YLLMRGELTNDVSSLLQVRPPTRSSWKGGVEALEHALSMESDVTKSIRNVIKACEDD--SEFNDYHLVDY
1zs3A1          LLLDENEIVPSTTEEFLKYHKFITEDPKAKTDEDLLESFIVDFQAQNMFITRAIKLANKEKFALAAGVVE
1bcfA           RILFLEGLPNLQ------DLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVH--DYVSRDMMIE
1b71A1          FLEGGDLEIVAAFPAGIIADTHANLIASAAGEHHEYTEMYPSFARIAREEG---------YEEIARVFAS
1aewA           MQNQRGGRALFQDLQKP----SQDEWGTTPDAMKAAIVLEKSLNQALLDLHALGSAQA--DPHLCDFLES
1nf4A           RIKELGGEPTTQKEGKVV--TGQAVPVIYESDADQEDATIEAYSQFLKVCKEQG------DIVTARLFER
1z6oA1          HVTKRGDKMNFDQHSTMKTERKNYTANHELEALAKALDTQKELAERAFYIHREATRNS--QHLHDPEIAQ


                         +         .         .         .         .         *         .:210
query           QAAELEKFQWFIRAHIVDVDGxxxx
2fjcA1          ILRTLGKAIWMLGATL---------
1mojA           GLIELEDDAHHIEHYLED-------
1uvhA1          HAGELEKFQWFVRAHLESAGG----
1o22A           WYKIYVPYSSVKKK-----------
1dpsA           ASRDLDKFLWFIECNI---------
1ji4A           QLAKLQKSIWMLQAHL---------
1ji5A           IYTELEKHAWMLRAFL---------
1z6oM1          LTGDFYKGQRDLAGKA---------
1zs3A1          LYGYNLQVIRNLAGDL---------
1bcfA           ILRDEEGHIDWLETEL---------
1b71A1          IAVAEEFHEKRFLDFA---------
1aewA           HLDEEVKLIKKMGDHL---------
1nf4A           IIEEEQAHLTYYENIG---------
1z6oA1          FIEDHAEKIRTLAGHT---------