[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cimm2:CIRG_00337

[Show Plain Result]

#ERROR : Can't open dsspfile "2i7pA.bssp"
#ERROR : Can't open dsspfile "2i7pB.bssp"
#ERROR : Can't open dsspfile "2i7nB.bssp"
#ERROR : Can't open dsspfile "2i7pD.bssp"
#ERROR : Can't open dsspfile "2i7pC.bssp"
#ERROR : Can't open dsspfile "2i7nA.bssp"

## Summary of PDB Search
:462
    2e-42  42%  2i7pA  [x.x.x] PANTOTHENATE KINASE 3
    7e-42  42%  2i7pB  [x.x.x] PANTOTHENATE KINASE 3
    9e-42  43%  2i7nB  [x.x.x] PANTOTHENATE KINASE 1
    6e-41  42%  2i7pD  [x.x.x] PANTOTHENATE KINASE 3
    1e-40  43%  2i7pC  [x.x.x] PANTOTHENATE KINASE 3
    1e-40  44%  2i7nA  [x.x.x] PANTOTHENATE KINASE 1
:462

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2i7pA           ----------------------------------------------------------------------
2i7pB           ----------------------------------------------------------------------
2i7nB           ----------------------------------------------------------------------
2i7pD           ----------------------------------------------------------------------
2i7pC           ----------------------------------------------------------------------
2i7nA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxVDIGGSLAKLVYFSPELGSSADGGRLNFLNFETERIDLCIDFLKQLKENH
2i7pA           --------------------MDIGGTLVKLSYFEPDLTLFGRRGNLHFIRFPTQDLPTFIQMGRD-----
2i7pB           --------------------MDIGGTLVKLSYFEPDLTLFGRRGNLHFIRFPTQDLPTFIQMGRD-----
2i7nB           --------------------MDIGGTLVKLVYFEPKLTSNTAYGKTGIRDVHLE--------LKNLTMRK
2i7pD           --------------------MDIGGTLVKLSYFEPDLTLFGRRGNLHFIRFPTQDLPTFIQMGRD-----
2i7pC           --------------------MDIGGTLVKLSYFEPYLTSNRDRGNLHFIRFPTQDLPTFIQMGRD-----
2i7nA           --------------------MDIGGTLVKLVYFEPKLTSNTAYGKTGIRDVHLE--------LKNLTMRK


                         +         .         .         .         .         *         .:210
query           RKLNGSAPGPLCIMATGGGAYKYYDRLKEELGVDIIREDEMECLIIGLDFFITEIPNEVFTYSETSPMEF
2i7pA           -KNFSTLQTVLC--ATGGGAYKFEKDFRTIGNLHLHKLDELDCLVKGL-LYIDSVQAECYYFANASEPER
2i7pB           -KNFSTLQTVLC--ATGGGAYKFEKDFRTIGNLHLHKLDELDCLVKGLLYIDSVSQAECYYFANASEPER
2i7nB           GNLH-FIRFPSCAMATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNECYYFENPTNPEL
2i7pD           -KNFSTLQTVLC--ATGGGAYKFEKDFRTIGNLHLHKLDELDCLVKGLLYIDSVSFNECYYFANASEPER
2i7pC           -KNFSTLQTVLC--ATGGGAYKFE---KDFGNLHLHKLDELDCLVKGLLYIDSVSFNECYYFANASEPER
2i7nA           GNLH-FIRFPSCAMATGGGAFKFEEDFLHKL-------DELDCLIQGLLYVDSVGFNECYYFENPTNPEL


                         .         .         .         +         .         .         .:280
query           AEARPDVYPYLLVNIGSGVSMVKVSAPRRFERVXXXXXXXXXXXXXMSLLTGARTFDEMLAMAELGDNSG
2i7pA           CQKMPDPYPLLVVNIGSGVSILAVHSKDNYKRVXXXXXXXXXXXXXXXXXXXXESFEEALEMASKGDSTQ
2i7pB           CQKMPDPYPLLVVNIGSGVSILAVHSKDNYKRVXXXXXXXXXXXXXXXXXXXXESFEEALEMASKGDSTQ
2i7nB           CQKKPNPYPMLLVNMGSGVSILAVYSKDNYKRVXXXXXXXXXXXXXXXXXXXXXXXXXALEMAAKGDSTN
2i7pD           CQKMPDPYPLLVVNIGSGVSILAVHSKDNYKRVXXXXXXXXXXXXXXXXXXXXESFEEALEMASKGDSTQ
2i7pC           CQKMPDPYPLLVVNIGSGVSILAVHSKDNYKRVXXXXXXXXXXXXXXXXXXXXESFEEALEMASKGDSTQ
2i7nA           CQKKPNPYPMLLVNMGSGVSILAVYSKDNYKRVXXXXXXXXXXXXXXXXXXXXXXXXXALEMAAKGDSTN


                         .         *         .         .         .         .         +:350
query           VDMLVGDIYGTDYTKIGLKSSTIASTFGKVFKMQRLAERSAQGXXXXXXXXXXXXRDVSQFRREDISRSL
2i7pA           ADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEKRESVS----------------------KEDLARAT
2i7pB           ADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEKRESVS----------------------KEDLARAT
2i7nB           VDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEK--------------------RD--SISKEDLARAT
2i7pD           ADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEKRESVS----------------------KEDLARAT
2i7pC           ADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEKRESVS----------------------KEDLARAT
2i7nA           VDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEK--------------------RD--SISKEDLARAT


                         .         .         .         .         *         .         .:420
query           LFAISNNIGQIAYLQSEKHQIKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAF
2i7pA           LVTITNNIGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAVGAL
2i7pB           LVTITNNIGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAVGAL
2i7nB           LVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGAL
2i7pD           LVTITNNIGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAVGAL
2i7pC           LVTITNNIGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAVGAL
2i7nA           LVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGAL


                         .         .         +         .         .         .         .:490
query           LKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2i7pA           L-----------------------------------------
2i7pB           L-----------------------------------------
2i7nB           LE----------------------------------------
2i7pD           L-----------------------------------------
2i7pC           L-----------------------------------------
2i7nA           LE----------------------------------------